Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 4217017..4217655 | Replicon | chromosome |
| Accession | NZ_OU342919 | ||
| Organism | Escherichia coli isolate UR21/11-869 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | LIX80_RS20530 | Protein ID | WP_000813794.1 |
| Coordinates | 4217479..4217655 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LIX80_RS20525 | Protein ID | WP_001270286.1 |
| Coordinates | 4217017..4217433 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIX80_RS20505 (4212169) | 4212169..4213110 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| LIX80_RS20510 (4213111) | 4213111..4214124 | - | 1014 | WP_226397320.1 | ABC transporter ATP-binding protein | - |
| LIX80_RS20515 (4214142) | 4214142..4215287 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| LIX80_RS20520 (4215532) | 4215532..4216938 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| LIX80_RS20525 (4217017) | 4217017..4217433 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| LIX80_RS20530 (4217479) | 4217479..4217655 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| LIX80_RS20535 (4217877) | 4217877..4218107 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| LIX80_RS20540 (4218199) | 4218199..4220160 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| LIX80_RS20545 (4220233) | 4220233..4220769 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| LIX80_RS20550 (4220861) | 4220861..4222036 | + | 1176 | WP_001236258.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T294746 WP_000813794.1 NZ_OU342919:c4217655-4217479 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT294746 WP_001270286.1 NZ_OU342919:c4217433-4217017 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|