Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3059804..3060429 | Replicon | chromosome |
Accession | NZ_OU342919 | ||
Organism | Escherichia coli isolate UR21/11-869 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | LIX80_RS14800 | Protein ID | WP_000911329.1 |
Coordinates | 3060031..3060429 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | LIX80_RS14795 | Protein ID | WP_000450524.1 |
Coordinates | 3059804..3060031 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX80_RS14770 (3055607) | 3055607..3056077 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
LIX80_RS14775 (3056077) | 3056077..3056649 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
LIX80_RS14780 (3056795) | 3056795..3057673 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
LIX80_RS14785 (3057690) | 3057690..3058724 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
LIX80_RS14790 (3058937) | 3058937..3059650 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
LIX80_RS14795 (3059804) | 3059804..3060031 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
LIX80_RS14800 (3060031) | 3060031..3060429 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LIX80_RS14805 (3060576) | 3060576..3061439 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
LIX80_RS14810 (3061454) | 3061454..3063469 | + | 2016 | WP_000829332.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
LIX80_RS14815 (3063543) | 3063543..3064241 | + | 699 | WP_000679812.1 | esterase | - |
LIX80_RS14820 (3064322) | 3064322..3064522 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T294739 WP_000911329.1 NZ_OU342919:3060031-3060429 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |