Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2698922..2699505 | Replicon | chromosome |
Accession | NZ_OU342919 | ||
Organism | Escherichia coli isolate UR21/11-869 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | LIX80_RS12980 | Protein ID | WP_000254745.1 |
Coordinates | 2699170..2699505 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | LIX80_RS12975 | Protein ID | WP_000581937.1 |
Coordinates | 2698922..2699170 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX80_RS12965 (2695261) | 2695261..2696562 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
LIX80_RS12970 (2696610) | 2696610..2698844 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
LIX80_RS12975 (2698922) | 2698922..2699170 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
LIX80_RS12980 (2699170) | 2699170..2699505 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
LIX80_RS12985 (2699576) | 2699576..2700367 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
LIX80_RS12990 (2700595) | 2700595..2702232 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
LIX80_RS12995 (2702320) | 2702320..2703618 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T294738 WP_000254745.1 NZ_OU342919:2699170-2699505 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 1UB4 | |
PDB | 5CQX | |
PDB | 5CQY | |
PDB | 1MVF | |
PDB | 2MRN | |
PDB | 2MRU | |
AlphaFold DB | A0A7U9LMB4 |