Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2554573..2555227 | Replicon | chromosome |
| Accession | NZ_OU342919 | ||
| Organism | Escherichia coli isolate UR21/11-869 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | LIX80_RS12320 | Protein ID | WP_000244777.1 |
| Coordinates | 2554820..2555227 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | LIX80_RS12315 | Protein ID | WP_000354046.1 |
| Coordinates | 2554573..2554839 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIX80_RS12290 (2549861) | 2549861..2550604 | + | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
| LIX80_RS12295 (2550661) | 2550661..2552094 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| LIX80_RS12300 (2552139) | 2552139..2552450 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| LIX80_RS12305 (2552614) | 2552614..2553273 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| LIX80_RS12310 (2553350) | 2553350..2554330 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| LIX80_RS12315 (2554573) | 2554573..2554839 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| LIX80_RS12320 (2554820) | 2554820..2555227 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| LIX80_RS12325 (2555267) | 2555267..2555788 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| LIX80_RS12330 (2555900) | 2555900..2556796 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| LIX80_RS12335 (2556821) | 2556821..2557531 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LIX80_RS12340 (2557537) | 2557537..2559270 | + | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T294737 WP_000244777.1 NZ_OU342919:2554820-2555227 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |