Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 1984702..1985502 | Replicon | chromosome |
Accession | NZ_OU342919 | ||
Organism | Escherichia coli isolate UR21/11-869 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4NNI0 |
Locus tag | LIX80_RS09465 | Protein ID | WP_000342449.1 |
Coordinates | 1984975..1985502 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | LIX80_RS09460 | Protein ID | WP_001277108.1 |
Coordinates | 1984702..1984968 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX80_RS09440 (1980360) | 1980360..1981028 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
LIX80_RS09445 (1981021) | 1981021..1982079 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
LIX80_RS09450 (1982324) | 1982324..1983178 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
LIX80_RS09455 (1983449) | 1983449..1984552 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
LIX80_RS09460 (1984702) | 1984702..1984968 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
LIX80_RS09465 (1984975) | 1984975..1985502 | + | 528 | WP_000342449.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
LIX80_RS09470 (1985499) | 1985499..1985882 | - | 384 | WP_000778785.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
LIX80_RS09475 (1986306) | 1986306..1987415 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
LIX80_RS09480 (1987463) | 1987463..1988389 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
LIX80_RS09485 (1988386) | 1988386..1989663 | + | 1278 | WP_047659341.1 | branched chain amino acid ABC transporter permease LivM | - |
LIX80_RS09490 (1989660) | 1989660..1990427 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T294735 WP_000342449.1 NZ_OU342919:1984975-1985502 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLZ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CN24 |