Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 489652..490489 | Replicon | chromosome |
Accession | NZ_OU342919 | ||
Organism | Escherichia coli isolate UR21/11-869 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | LIX80_RS02420 | Protein ID | WP_000227784.1 |
Coordinates | 489947..490489 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | LIX80_RS02415 | Protein ID | WP_001297137.1 |
Coordinates | 489652..489963 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX80_RS02390 (484672) | 484672..485619 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
LIX80_RS02395 (485641) | 485641..487632 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
LIX80_RS02400 (487622) | 487622..488236 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
LIX80_RS02405 (488236) | 488236..488565 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
LIX80_RS02410 (488577) | 488577..489467 | + | 891 | WP_000971336.1 | heme o synthase | - |
LIX80_RS02415 (489652) | 489652..489963 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
LIX80_RS02420 (489947) | 489947..490489 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
LIX80_RS02425 (490545) | 490545..491342 | - | 798 | WP_226397351.1 | tetratricopeptide repeat protein | - |
LIX80_RS02430 (491446) | 491446..492608 | + | 1163 | WP_111961598.1 | IS3-like element IS3 family transposase | - |
LIX80_RS02435 (492640) | 492640..492801 | - | 162 | Protein_468 | sel1 repeat family protein | - |
LIX80_RS02440 (493149) | 493149..494513 | + | 1365 | WP_001000978.1 | MFS transporter | - |
LIX80_RS02445 (494641) | 494641..495132 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T294728 WP_000227784.1 NZ_OU342919:489947-490489 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|