Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 455574..456192 | Replicon | chromosome |
Accession | NZ_OU342919 | ||
Organism | Escherichia coli isolate UR21/11-869 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | LIX80_RS02250 | Protein ID | WP_001291435.1 |
Coordinates | 455974..456192 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | LIX80_RS02245 | Protein ID | WP_000344800.1 |
Coordinates | 455574..455948 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX80_RS02235 (450663) | 450663..451856 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LIX80_RS02240 (451879) | 451879..455028 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
LIX80_RS02245 (455574) | 455574..455948 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
LIX80_RS02250 (455974) | 455974..456192 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
LIX80_RS02255 (456364) | 456364..456915 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
LIX80_RS02260 (457031) | 457031..457501 | + | 471 | WP_000136192.1 | YlaC family protein | - |
LIX80_RS02265 (457665) | 457665..459215 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
LIX80_RS02270 (459257) | 459257..459610 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
LIX80_RS02280 (459989) | 459989..460300 | + | 312 | WP_000409911.1 | MGMT family protein | - |
LIX80_RS02285 (460331) | 460331..460903 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T294727 WP_001291435.1 NZ_OU342919:455974-456192 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT294727 WP_000344800.1 NZ_OU342919:455574-455948 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |