Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 70371..70896 Replicon plasmid p4
Accession NZ_OU342710
Organism Klebsiella pneumoniae strain Kp1 isolate Kp1

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag KXF33_RS28775 Protein ID WP_001159871.1
Coordinates 70371..70676 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag KXF33_RS28780 Protein ID WP_000813630.1
Coordinates 70678..70896 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KXF33_RS28750 (65847) 65847..67382 + 1536 WP_001282376.1 pore-forming bacteriocin colicin B -
KXF33_RS28755 (67400) 67400..67927 - 528 WP_000203268.1 colicin B immunity protein -
KXF33_RS28760 (68170) 68170..68985 + 816 WP_000449473.1 lipid II-degrading bacteriocin colicin M -
KXF33_RS28765 (69035) 69035..69388 - 354 WP_000864812.1 colicin M immunity protein -
KXF33_RS28770 (69561) 69561..70370 - 810 WP_021514797.1 site-specific integrase -
KXF33_RS28775 (70371) 70371..70676 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
KXF33_RS28780 (70678) 70678..70896 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
KXF33_RS28785 (71741) 71741..72979 + 1239 WP_024188128.1 DegT/DnrJ/EryC1/StrS family aminotransferase -
KXF33_RS28790 (72963) 72963..73793 + 831 WP_016230897.1 HAD-IIB family hydrolase -
KXF33_RS28795 (73793) 73793..74809 + 1017 WP_016230896.1 Gfo/Idh/MocA family oxidoreductase -
KXF33_RS28800 (74811) 74811..75080 + 270 WP_000379710.1 SemiSWEET transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..80027 80027


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T294726 WP_001159871.1 NZ_OU342710:c70676-70371 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT294726 WP_000813630.1 NZ_OU342710:c70896-70678 [Klebsiella pneumoniae]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References