Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 95371..96014 Replicon plasmid p2
Accession NZ_OU342708
Organism Klebsiella pneumoniae strain Kp1 isolate Kp1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag KXF33_RS27795 Protein ID WP_001044770.1
Coordinates 95598..96014 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag KXF33_RS27790 Protein ID WP_001261282.1
Coordinates 95371..95601 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KXF33_RS27755 (KP1VIM_05528) 90968..91834 - 867 WP_004118283.1 replication initiation protein -
KXF33_RS27760 92369..92473 + 105 WP_032409716.1 hypothetical protein -
KXF33_RS27765 (KP1VIM_05529) 92602..92859 + 258 WP_000764642.1 hypothetical protein -
KXF33_RS27770 (KP1VIM_05530) 92917..93693 - 777 WP_000015958.1 site-specific integrase -
KXF33_RS27775 (KP1VIM_05531) 93690..94433 - 744 WP_000129823.1 hypothetical protein -
KXF33_RS27780 (KP1VIM_05532) 94481..94801 - 321 WP_099718778.1 hypothetical protein -
KXF33_RS27785 94954..95414 - 461 Protein_111 hypothetical protein -
KXF33_RS27790 (KP1VIM_05533) 95371..95601 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
KXF33_RS27795 (KP1VIM_05534) 95598..96014 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
KXF33_RS27800 (KP1VIM_05535) 96088..96777 + 690 Protein_114 AAA family ATPase -
KXF33_RS27805 96832..97529 + 698 WP_223174630.1 IS1 family transposase -
KXF33_RS27810 97545..97655 + 111 Protein_116 mercuric transport protein periplasmic component -
KXF33_RS27815 (KP1VIM_05538) 97691..98113 + 423 WP_001340589.1 organomercurial transporter MerC -
KXF33_RS27820 (KP1VIM_05539) 98165..99859 + 1695 WP_000105636.1 mercury(II) reductase -
KXF33_RS27825 (KP1VIM_05540) 99877..100239 + 363 WP_001277456.1 mercury resistance co-regulator MerD -
KXF33_RS27830 (KP1VIM_05541) 100236..100472 + 237 WP_000993386.1 broad-spectrum mercury transporter MerE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaSHV-12 / dfrA14 / tet(D) / catA2 / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / qnrA1 / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib - 1..110924 110924


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T294722 WP_001044770.1 NZ_OU342708:95598-96014 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT294722 WP_001261282.1 NZ_OU342708:95371-95601 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References