Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4477023..4477539 | Replicon | chromosome |
Accession | NZ_OU342706 | ||
Organism | Klebsiella pneumoniae strain Kp1 isolate Kp1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | KXF33_RS21950 | Protein ID | WP_004178374.1 |
Coordinates | 4477023..4477307 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | KXF33_RS21955 | Protein ID | WP_002886901.1 |
Coordinates | 4477297..4477539 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KXF33_RS21925 (KP1VIM_04356) | 4472440..4472748 | - | 309 | WP_019725542.1 | PTS sugar transporter subunit IIB | - |
KXF33_RS21930 | 4472833..4473006 | + | 174 | WP_019725541.1 | hypothetical protein | - |
KXF33_RS21935 (KP1VIM_04357) | 4473009..4473752 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
KXF33_RS21940 (KP1VIM_04358) | 4474109..4476247 | + | 2139 | WP_019725540.1 | anaerobic ribonucleoside-triphosphate reductase | - |
KXF33_RS21945 (KP1VIM_04359) | 4476555..4477019 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
KXF33_RS21950 (KP1VIM_04360) | 4477023..4477307 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KXF33_RS21955 (KP1VIM_04361) | 4477297..4477539 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
KXF33_RS21960 (KP1VIM_04362) | 4477617..4479527 | - | 1911 | WP_019725539.1 | PRD domain-containing protein | - |
KXF33_RS21965 (KP1VIM_04363) | 4479550..4480704 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
KXF33_RS21970 (KP1VIM_04364) | 4480771..4481511 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T294719 WP_004178374.1 NZ_OU342706:c4477307-4477023 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |