Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4395673..4396364 | Replicon | chromosome |
| Accession | NZ_OU342706 | ||
| Organism | Klebsiella pneumoniae strain Kp1 isolate Kp1 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A483YFJ1 |
| Locus tag | KXF33_RS21610 | Protein ID | WP_025987721.1 |
| Coordinates | 4395673..4396014 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A2A5MHA6 |
| Locus tag | KXF33_RS21615 | Protein ID | WP_019725272.1 |
| Coordinates | 4396038..4396364 (-) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KXF33_RS21595 (KP1VIM_04289) | 4392646..4393881 | - | 1236 | WP_124044824.1 | hypothetical protein | - |
| KXF33_RS21600 (KP1VIM_04290) | 4394327..4394698 | - | 372 | WP_223369725.1 | hypothetical protein | - |
| KXF33_RS21605 (KP1VIM_04291) | 4394725..4395558 | - | 834 | WP_025987720.1 | DUF4942 domain-containing protein | - |
| KXF33_RS21610 (KP1VIM_04292) | 4395673..4396014 | - | 342 | WP_025987721.1 | TA system toxin CbtA family protein | Toxin |
| KXF33_RS21615 (KP1VIM_04293) | 4396038..4396364 | - | 327 | WP_019725272.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KXF33_RS21620 (KP1VIM_04294) | 4396378..4396854 | - | 477 | WP_019725273.1 | DNA repair protein RadC | - |
| KXF33_RS21625 (KP1VIM_04295) | 4396864..4397310 | - | 447 | WP_025987722.1 | antirestriction protein | - |
| KXF33_RS21630 (KP1VIM_04296) | 4397522..4398211 | - | 690 | WP_009309812.1 | hypothetical protein | - |
| KXF33_RS21635 (KP1VIM_04297) | 4398776..4399666 | - | 891 | WP_019725276.1 | YfjP family GTPase | - |
| KXF33_RS21640 (KP1VIM_04298) | 4399749..4400837 | - | 1089 | WP_019725277.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4378605..4418774 | 40169 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12867.90 Da Isoelectric Point: 8.5195
>T294718 WP_025987721.1 NZ_OU342706:c4396014-4395673 [Klebsiella pneumoniae]
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483YFJ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MHA6 |