Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3736410..3737029 Replicon chromosome
Accession NZ_OU342706
Organism Klebsiella pneumoniae strain Kp1 isolate Kp1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag KXF33_RS18440 Protein ID WP_002892050.1
Coordinates 3736811..3737029 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag KXF33_RS18435 Protein ID WP_002892066.1
Coordinates 3736410..3736784 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KXF33_RS18425 (KP1VIM_03653) 3731562..3732755 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
KXF33_RS18430 (KP1VIM_03654) 3732778..3735924 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
KXF33_RS18435 (KP1VIM_03655) 3736410..3736784 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
KXF33_RS18440 (KP1VIM_03656) 3736811..3737029 + 219 WP_002892050.1 HHA domain-containing protein Toxin
KXF33_RS18445 (KP1VIM_03657) 3737192..3737758 + 567 WP_002892030.1 maltose O-acetyltransferase -
KXF33_RS18450 3737730..3737870 - 141 WP_004147370.1 hypothetical protein -
KXF33_RS18455 (KP1VIM_03658) 3737891..3738361 + 471 WP_002892026.1 YlaC family protein -
KXF33_RS18460 (KP1VIM_03659) 3738336..3739787 - 1452 WP_064145206.1 PLP-dependent aminotransferase family protein -
KXF33_RS18465 (KP1VIM_03660) 3739888..3740586 + 699 WP_004177238.1 GNAT family protein -
KXF33_RS18470 (KP1VIM_03661) 3740583..3740723 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
KXF33_RS18475 (KP1VIM_03662) 3740723..3740986 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T294716 WP_002892050.1 NZ_OU342706:3736811-3737029 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT294716 WP_002892066.1 NZ_OU342706:3736410-3736784 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References