Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 48667..49274 Replicon plasmid pl1
Accession NZ_OU016037
Organism Enterococcus faecium isolate USZ_VRE53_P46

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag KKQ98_RS14285 Protein ID WP_213313539.1
Coordinates 48924..49274 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag KKQ98_RS14280 Protein ID WP_002287514.1
Coordinates 48667..48930 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KKQ98_RS14240 43703..44602 + 900 WP_002322787.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
KKQ98_RS14245 44605..45090 + 486 WP_002296241.1 single-stranded DNA-binding protein -
KKQ98_RS14250 45456..45716 + 261 WP_002296240.1 hypothetical protein -
KKQ98_RS14255 46157..46363 + 207 WP_002296239.1 hypothetical protein -
KKQ98_RS14260 46363..46614 + 252 WP_002296238.1 hypothetical protein -
KKQ98_RS14265 46629..47066 + 438 WP_002296237.1 hypothetical protein -
KKQ98_RS14270 47059..47766 + 708 WP_002353391.1 hypothetical protein -
KKQ98_RS16350 47931..48131 + 201 WP_002330566.1 hypothetical protein -
KKQ98_RS14275 48147..48326 + 180 WP_002305761.1 hypothetical protein -
KKQ98_RS14280 48667..48930 + 264 WP_002287514.1 hypothetical protein Antitoxin
KKQ98_RS14285 48924..49274 + 351 WP_213313539.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
KKQ98_RS14290 49298..49912 - 615 WP_010729795.1 recombinase family protein -
KKQ98_RS14295 50226..50648 + 423 WP_002288787.1 hypothetical protein -
KKQ98_RS14300 50658..50861 + 204 WP_002299573.1 hypothetical protein -
KKQ98_RS14305 51072..51656 + 585 WP_002299575.1 recombinase family protein -
KKQ98_RS14310 51845..52525 - 681 WP_010861579.1 IS6-like element IS1216 family transposase -
KKQ98_RS14315 52601..53244 - 644 Protein_55 IS3-like element ISEfa8 family transposase -
KKQ98_RS14320 53519..54061 + 543 WP_002298088.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(2'')-Ia / aac(6')-aph(2'') - 1..204460 204460


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(5-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13282.34 Da        Isoelectric Point: 8.8133

>T294704 WP_213313539.1 NZ_OU016037:48924-49274 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSKTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT294704 WP_002287514.1 NZ_OU016037:48667-48930 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References