Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 500048..500619 | Replicon | chromosome |
Accession | NZ_OU016036 | ||
Organism | Enterococcus faecium isolate USZ_VRE53_P46 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | KKQ98_RS02385 | Protein ID | WP_002286801.1 |
Coordinates | 500278..500619 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | KKQ98_RS02380 | Protein ID | WP_002323011.1 |
Coordinates | 500048..500278 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KKQ98_RS02350 | 495181..496512 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
KKQ98_RS02355 | 496534..497160 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
KKQ98_RS02360 | 497343..497924 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
KKQ98_RS16205 | 498656..499218 | + | 563 | Protein_467 | SOS response-associated peptidase family protein | - |
KKQ98_RS02375 | 499423..499761 | - | 339 | WP_002286804.1 | hypothetical protein | - |
KKQ98_RS02380 | 500048..500278 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
KKQ98_RS02385 | 500278..500619 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
KKQ98_RS02390 | 501682..502808 | + | 1127 | WP_094850654.1 | IS3 family transposase | - |
KKQ98_RS02395 | 503411..503605 | + | 195 | WP_002297028.1 | hypothetical protein | - |
KKQ98_RS02400 | 503796..504045 | + | 250 | Protein_473 | transposase | - |
KKQ98_RS02405 | 504289..505119 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T294703 WP_002286801.1 NZ_OU016036:500278-500619 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |