Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 498253..498824 | Replicon | chromosome |
| Accession | NZ_OU015946 | ||
| Organism | Enterococcus faecium isolate USZ_VRE5_P5 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | KKQ94_RS02380 | Protein ID | WP_002286801.1 |
| Coordinates | 498483..498824 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | KKQ94_RS02375 | Protein ID | WP_002323011.1 |
| Coordinates | 498253..498483 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KKQ94_RS02345 | 493386..494717 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
| KKQ94_RS02350 | 494739..495365 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| KKQ94_RS02355 | 495548..496129 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| KKQ94_RS15495 | 496861..497423 | + | 563 | Protein_466 | SOS response-associated peptidase family protein | - |
| KKQ94_RS02370 | 497628..497966 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| KKQ94_RS02375 | 498253..498483 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| KKQ94_RS02380 | 498483..498824 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| KKQ94_RS02385 | 499887..501013 | + | 1127 | WP_094850654.1 | IS3 family transposase | - |
| KKQ94_RS02390 | 501616..501810 | + | 195 | WP_002297028.1 | hypothetical protein | - |
| KKQ94_RS02395 | 502001..502250 | + | 250 | Protein_472 | transposase | - |
| KKQ94_RS02400 | 502494..503324 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T294692 WP_002286801.1 NZ_OU015946:498483-498824 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |