Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2834790..2835370 | Replicon | chromosome |
Accession | NZ_OU015584 | ||
Organism | Parvicella tangerina strain AS29M-1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NYQ84_RS12490 | Protein ID | WP_258542749.1 |
Coordinates | 2834790..2835089 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NYQ84_RS12495 | Protein ID | WP_258542750.1 |
Coordinates | 2835089..2835370 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYQ84_RS12480 (CRYO30217_02525) | 2831008..2832828 | + | 1821 | WP_258542747.1 | 30S ribosomal protein S1 | - |
NYQ84_RS12485 (CRYO30217_02526) | 2832949..2834541 | + | 1593 | WP_258542748.1 | hypothetical protein | - |
NYQ84_RS12490 (CRYO30217_02527) | 2834790..2835089 | + | 300 | WP_258542749.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYQ84_RS12495 (CRYO30217_02528) | 2835089..2835370 | + | 282 | WP_258542750.1 | putative addiction module antidote protein | Antitoxin |
NYQ84_RS12500 (CRYO30217_02529) | 2835465..2835773 | + | 309 | WP_258542751.1 | hypothetical protein | - |
NYQ84_RS12505 (CRYO30217_02531) | 2836068..2836898 | + | 831 | WP_258542752.1 | hypothetical protein | - |
NYQ84_RS12510 (CRYO30217_02532) | 2836990..2837739 | + | 750 | WP_258542753.1 | DUF2071 domain-containing protein | - |
NYQ84_RS12515 (CRYO30217_02533) | 2837805..2838137 | + | 333 | WP_258542754.1 | hypothetical protein | - |
NYQ84_RS12520 (CRYO30217_02534) | 2838579..2838971 | + | 393 | WP_258542755.1 | hypothetical protein | - |
NYQ84_RS12525 (CRYO30217_02535) | 2839143..2839574 | + | 432 | WP_258542756.1 | OsmC family peroxiredoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11640.56 Da Isoelectric Point: 10.2678
>T294685 WP_258542749.1 NZ_OU015584:2834790-2835089 [Parvicella tangerina]
MYIIEKTPEFDKWLRKLKDRRAKAKILFRIQRIEEQGNFGDCQPIGEGLSELRIHYAKGYRVYIKEYSGTIVILLNGGDK
STQSKDIAKAKDLWTKYKK
MYIIEKTPEFDKWLRKLKDRRAKAKILFRIQRIEEQGNFGDCQPIGEGLSELRIHYAKGYRVYIKEYSGTIVILLNGGDK
STQSKDIAKAKDLWTKYKK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|