294682

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 50133..50652 Replicon plasmid P02
Accession NZ_OU015352
Organism Enterococcus faecium strain AUS2002 isolate AUS2002

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag K3T69_RS15670 Protein ID WP_000588503.1
Coordinates 50395..50652 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag K3T69_RS15665 Protein ID WP_000388479.1
Coordinates 50133..50402 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K3T69_RS15620 45330..46229 + 900 WP_002303312.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
K3T69_RS15625 46232..46717 + 486 WP_002303313.1 single-stranded DNA-binding protein -
K3T69_RS16255 46858..46962 - 105 WP_008274030.1 putative holin-like toxin -
K3T69_RS15635 47136..47396 + 261 WP_002295623.1 hypothetical protein -
K3T69_RS15640 47833..48039 + 207 WP_002347218.1 hypothetical protein -
K3T69_RS15645 48039..48290 + 252 WP_002296238.1 hypothetical protein -
K3T69_RS15650 48305..48742 + 438 WP_002300851.1 hypothetical protein -
K3T69_RS15655 48735..49442 + 708 WP_002303117.1 hypothetical protein -
K3T69_RS16260 49607..49807 + 201 WP_002347143.1 hypothetical protein -
K3T69_RS15660 49823..50002 + 180 WP_001120991.1 hypothetical protein -
K3T69_RS15665 50133..50402 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
K3T69_RS15670 50395..50652 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
K3T69_RS15675 51111..51266 + 156 WP_002347142.1 hypothetical protein -
K3T69_RS15680 51290..51910 + 621 WP_258880530.1 hypothetical protein -
K3T69_RS16265 51913..52113 + 201 WP_060811965.1 hypothetical protein -
K3T69_RS15685 52278..52892 - 615 WP_001261742.1 recombinase family protein -
K3T69_RS15690 53130..53552 + 423 WP_002303116.1 hypothetical protein -
K3T69_RS15695 53562..53765 + 204 WP_002299573.1 hypothetical protein -
K3T69_RS15700 53976..54560 + 585 WP_002299575.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..65209 65209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T294682 WP_000588503.1 NZ_OU015352:50395-50652 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT294682 WP_000388479.1 NZ_OU015352:50133-50402 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References