Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 48351..48870 Replicon plasmid P02
Accession NZ_OU015347
Organism Enterococcus faecium strain AUS2001 isolate AUS2001

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag K3836_RS14805 Protein ID WP_000588503.1
Coordinates 48613..48870 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag K3836_RS14800 Protein ID WP_000388479.1
Coordinates 48351..48620 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K3836_RS14755 43548..44447 + 900 WP_002303312.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
K3836_RS14760 44450..44935 + 486 WP_002303313.1 single-stranded DNA-binding protein -
K3836_RS15435 45076..45180 - 105 WP_008274030.1 putative holin-like toxin -
K3836_RS14770 45354..45614 + 261 WP_002295623.1 hypothetical protein -
K3836_RS14775 46051..46257 + 207 WP_002347218.1 hypothetical protein -
K3836_RS14780 46257..46508 + 252 WP_002296238.1 hypothetical protein -
K3836_RS14785 46523..46960 + 438 WP_002300851.1 hypothetical protein -
K3836_RS14790 46953..47660 + 708 WP_002303117.1 hypothetical protein -
K3836_RS15440 47825..48025 + 201 WP_002347143.1 hypothetical protein -
K3836_RS14795 48041..48220 + 180 WP_001120991.1 hypothetical protein -
K3836_RS14800 48351..48620 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
K3836_RS14805 48613..48870 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
K3836_RS14810 49329..49484 + 156 WP_002347142.1 hypothetical protein -
K3836_RS14815 49508..50128 + 621 WP_258880530.1 hypothetical protein -
K3836_RS15445 50098..50331 + 234 WP_002296232.1 hypothetical protein -
K3836_RS14820 50496..51110 - 615 WP_001261742.1 recombinase family protein -
K3836_RS14825 51348..51770 + 423 WP_002303116.1 hypothetical protein -
K3836_RS14830 51780..51983 + 204 WP_002299573.1 hypothetical protein -
K3836_RS14835 52194..52778 + 585 WP_002299575.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..63427 63427


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T294676 WP_000588503.1 NZ_OU015347:48613-48870 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT294676 WP_000388479.1 NZ_OU015347:48351-48620 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References