Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2141481..2142052 | Replicon | chromosome |
| Accession | NZ_OU015345 | ||
| Organism | Enterococcus faecium strain AUS2001 isolate AUS2001 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | K3836_RS10440 | Protein ID | WP_002286801.1 |
| Coordinates | 2141481..2141822 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | K3836_RS10445 | Protein ID | WP_002323011.1 |
| Coordinates | 2141822..2142052 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K3836_RS10415 | 2136691..2138025 | - | 1335 | WP_002303373.1 | ABC transporter substrate-binding protein | - |
| K3836_RS10420 | 2138233..2139063 | + | 831 | WP_002286789.1 | manganese catalase family protein | - |
| K3836_RS10425 | 2139307..2139556 | - | 250 | Protein_2057 | transposase | - |
| K3836_RS10430 | 2139747..2139941 | - | 195 | WP_002297028.1 | hypothetical protein | - |
| K3836_RS10435 | 2140446..2140631 | - | 186 | WP_002304207.1 | hypothetical protein | - |
| K3836_RS10440 | 2141481..2141822 | - | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| K3836_RS10445 | 2141822..2142052 | - | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| K3836_RS10450 | 2142339..2142677 | + | 339 | WP_002286804.1 | hypothetical protein | - |
| K3836_RS15360 | 2142882..2143444 | - | 563 | Protein_2063 | SOS response-associated peptidase | - |
| K3836_RS10465 | 2144176..2144757 | - | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| K3836_RS10470 | 2144940..2145566 | - | 627 | WP_002286816.1 | cysteine hydrolase | - |
| K3836_RS10475 | 2145588..2146919 | - | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T294674 WP_002286801.1 NZ_OU015345:c2141822-2141481 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |