Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 2388357..2388933 | Replicon | chromosome |
Accession | NZ_OU015323 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00004549 isolate AUSMDU00004549 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | KKQ99_RS12220 | Protein ID | WP_001131963.1 |
Coordinates | 2388646..2388933 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | B5R9R5 |
Locus tag | KKQ99_RS12215 | Protein ID | WP_000063142.1 |
Coordinates | 2388357..2388659 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KKQ99_RS12200 (2384867) | 2384867..2387017 | + | 2151 | WP_000379927.1 | pyruvate/proton symporter BtsT | - |
KKQ99_RS12205 (2387112) | 2387112..2387315 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
KKQ99_RS12210 (2387326) | 2387326..2388282 | + | 957 | WP_000187839.1 | GTPase | - |
KKQ99_RS12215 (2388357) | 2388357..2388659 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
KKQ99_RS12220 (2388646) | 2388646..2388933 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
KKQ99_RS12225 (2389202) | 2389202..2390116 | - | 915 | WP_000290512.1 | restriction endonuclease | - |
KKQ99_RS12230 (2390314) | 2390314..2393823 | + | 3510 | WP_001043484.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T294618 WP_001131963.1 NZ_OU015323:c2388933-2388646 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11373.96 Da Isoelectric Point: 10.1293
>AT294618 WP_000063142.1 NZ_OU015323:c2388659-2388357 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|