Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1743619..1744239 | Replicon | chromosome |
Accession | NZ_OU015323 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00004549 isolate AUSMDU00004549 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | KKQ99_RS09045 | Protein ID | WP_001280991.1 |
Coordinates | 1744021..1744239 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | KKQ99_RS09040 | Protein ID | WP_000344807.1 |
Coordinates | 1743619..1743993 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KKQ99_RS09025 (1738757) | 1738757..1741906 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
KKQ99_RS09030 (1742398) | 1742398..1742712 | + | 315 | WP_039026396.1 | transposase | - |
KKQ99_RS09035 (1742787) | 1742787..1743530 | + | 744 | WP_229038580.1 | IS3 family transposase | - |
KKQ99_RS09040 (1743619) | 1743619..1743993 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
KKQ99_RS09045 (1744021) | 1744021..1744239 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
KKQ99_RS09050 (1744418) | 1744418..1744969 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
KKQ99_RS09055 (1745086) | 1745086..1745556 | + | 471 | WP_000136181.1 | YlaC family protein | - |
KKQ99_RS09060 (1745612) | 1745612..1745752 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
KKQ99_RS09065 (1745758) | 1745758..1746018 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
KKQ99_RS09070 (1746243) | 1746243..1747793 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
KKQ99_RS09080 (1748024) | 1748024..1748413 | + | 390 | WP_000961285.1 | MGMT family protein | - |
KKQ99_RS09085 (1748446) | 1748446..1749015 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T294615 WP_001280991.1 NZ_OU015323:1744021-1744239 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT294615 WP_000344807.1 NZ_OU015323:1743619-1743993 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|