Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 2453722..2454269 | Replicon | chromosome |
Accession | NZ_OU015319 | ||
Organism | Cloacibacterium caeni isolate Isolate1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | KKQ79_RS11415 | Protein ID | WP_213190241.1 |
Coordinates | 2453722..2454021 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | KKQ79_RS11420 | Protein ID | WP_213190242.1 |
Coordinates | 2454024..2454269 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KKQ79_RS11385 | 2449060..2449614 | + | 555 | WP_213190236.1 | type II secretion system protein GspG | - |
KKQ79_RS11390 | 2449616..2450290 | + | 675 | WP_213190237.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
KKQ79_RS11395 | 2450326..2450880 | + | 555 | WP_250131245.1 | YdeI/OmpD-associated family protein | - |
KKQ79_RS11400 | 2450985..2451728 | + | 744 | WP_069799888.1 | 3-oxoacyl-[acyl-carrier-protein] reductase | - |
KKQ79_RS11405 | 2451836..2452414 | + | 579 | WP_213190239.1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | - |
KKQ79_RS11410 | 2452642..2453685 | - | 1044 | WP_213190240.1 | GMP reductase | - |
KKQ79_RS11415 | 2453722..2454021 | - | 300 | WP_213190241.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KKQ79_RS11420 | 2454024..2454269 | - | 246 | WP_213190242.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
KKQ79_RS11425 | 2454638..2455369 | - | 732 | WP_213190243.1 | hypothetical protein | - |
KKQ79_RS11430 | 2455903..2456763 | - | 861 | WP_213190244.1 | TraB/GumN family protein | - |
KKQ79_RS11435 | 2456925..2457692 | - | 768 | WP_213190245.1 | 5'/3'-nucleotidase SurE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 12084.67 Da Isoelectric Point: 4.6983
>T294609 WP_213190241.1 NZ_OU015319:c2454021-2453722 [Cloacibacterium caeni]
MNYKISIEAEKDLENIWLYTLENWSIEQADYYFDLIMNEIEYLAENPKFGQDFGEVRKGYFRSRVKSHFIFYRINLKNND
IEIIRILHQQMDVDSHLNV
MNYKISIEAEKDLENIWLYTLENWSIEQADYYFDLIMNEIEYLAENPKFGQDFGEVRKGYFRSRVKSHFIFYRINLKNND
IEIIRILHQQMDVDSHLNV
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|