Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1776906..1777600 Replicon chromosome
Accession NZ_OD940440
Organism Enterococcus faecalis isolate WE0254

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag KG893_RS08820 Protein ID WP_002378467.1
Coordinates 1777256..1777600 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag KG893_RS08815 Protein ID WP_002392358.1
Coordinates 1776906..1777238 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KG893_RS08770 (1772316) 1772316..1772633 - 318 WP_002357007.1 hypothetical protein -
KG893_RS08775 (1772853) 1772853..1773407 + 555 WP_002357006.1 hypothetical protein -
KG893_RS08780 (1773692) 1773692..1774030 - 339 WP_002357003.1 hypothetical protein -
KG893_RS08785 (1774067) 1774067..1774276 - 210 WP_002357002.1 hypothetical protein -
KG893_RS08790 (1774331) 1774331..1774519 + 189 WP_002357001.1 YegP family protein -
KG893_RS08795 (1774545) 1774545..1775270 - 726 WP_010730824.1 ORF6C domain-containing protein -
KG893_RS08800 (1775309) 1775309..1775620 - 312 WP_002381719.1 hypothetical protein -
KG893_RS08805 (1776217) 1776217..1776414 - 198 WP_010712611.1 hypothetical protein -
KG893_RS08810 (1776427) 1776427..1776609 - 183 WP_002358110.1 hypothetical protein -
KG893_RS08815 (1776906) 1776906..1777238 + 333 WP_002392358.1 helix-turn-helix transcriptional regulator Antitoxin
KG893_RS08820 (1777256) 1777256..1777600 + 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
KG893_RS08825 (1777636) 1777636..1778364 + 729 WP_002378468.1 potassium channel family protein -
KG893_RS08830 (1778464) 1778464..1779612 + 1149 WP_002388210.1 site-specific integrase -
KG893_RS08835 (1779640) 1779640..1780083 - 444 WP_025192396.1 competence type IV pilus minor pilin ComGD -
KG893_RS08840 (1780080) 1780080..1780355 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
KG893_RS08845 (1780355) 1780355..1781401 - 1047 WP_002356990.1 competence type IV pilus assembly protein ComGB -
KG893_RS08850 (1781358) 1781358..1782326 - 969 WP_002364362.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1740138..1798462 58324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-59)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T294590 WP_002378467.1 NZ_OD940440:1777256-1777600 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12660.01 Da        Isoelectric Point: 4.5116

>AT294590 WP_002392358.1 NZ_OD940440:1776906-1777238 [Enterococcus faecalis]
MNTYEIIKDLAKEKGISIRQLEINFGYSNGYIGSWKRQTPNSNELSRLADYFDVSVDYLLGRTDNTKATDEKKSDDLDDV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References