Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1776906..1777600 | Replicon | chromosome |
| Accession | NZ_OD940440 | ||
| Organism | Enterococcus faecalis isolate WE0254 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | S4BLV4 |
| Locus tag | KG893_RS08820 | Protein ID | WP_002378467.1 |
| Coordinates | 1777256..1777600 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | KG893_RS08815 | Protein ID | WP_002392358.1 |
| Coordinates | 1776906..1777238 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KG893_RS08770 (1772316) | 1772316..1772633 | - | 318 | WP_002357007.1 | hypothetical protein | - |
| KG893_RS08775 (1772853) | 1772853..1773407 | + | 555 | WP_002357006.1 | hypothetical protein | - |
| KG893_RS08780 (1773692) | 1773692..1774030 | - | 339 | WP_002357003.1 | hypothetical protein | - |
| KG893_RS08785 (1774067) | 1774067..1774276 | - | 210 | WP_002357002.1 | hypothetical protein | - |
| KG893_RS08790 (1774331) | 1774331..1774519 | + | 189 | WP_002357001.1 | YegP family protein | - |
| KG893_RS08795 (1774545) | 1774545..1775270 | - | 726 | WP_010730824.1 | ORF6C domain-containing protein | - |
| KG893_RS08800 (1775309) | 1775309..1775620 | - | 312 | WP_002381719.1 | hypothetical protein | - |
| KG893_RS08805 (1776217) | 1776217..1776414 | - | 198 | WP_010712611.1 | hypothetical protein | - |
| KG893_RS08810 (1776427) | 1776427..1776609 | - | 183 | WP_002358110.1 | hypothetical protein | - |
| KG893_RS08815 (1776906) | 1776906..1777238 | + | 333 | WP_002392358.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| KG893_RS08820 (1777256) | 1777256..1777600 | + | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| KG893_RS08825 (1777636) | 1777636..1778364 | + | 729 | WP_002378468.1 | potassium channel family protein | - |
| KG893_RS08830 (1778464) | 1778464..1779612 | + | 1149 | WP_002388210.1 | site-specific integrase | - |
| KG893_RS08835 (1779640) | 1779640..1780083 | - | 444 | WP_025192396.1 | competence type IV pilus minor pilin ComGD | - |
| KG893_RS08840 (1780080) | 1780080..1780355 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| KG893_RS08845 (1780355) | 1780355..1781401 | - | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| KG893_RS08850 (1781358) | 1781358..1782326 | - | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1740138..1798462 | 58324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T294590 WP_002378467.1 NZ_OD940440:1777256-1777600 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|