Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 580227..581335 | Replicon | chromosome |
Accession | NZ_OD940440 | ||
Organism | Enterococcus faecalis isolate WE0254 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | A0A2H4HI44 |
Locus tag | KG893_RS03000 | Protein ID | WP_029170889.1 |
Coordinates | 580466..581335 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | KG893_RS02995 | Protein ID | WP_000205227.1 |
Coordinates | 580227..580451 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KG893_RS02960 (575543) | 575543..576223 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
KG893_RS02965 (576291) | 576291..576618 | + | 328 | Protein_569 | recombinase family protein | - |
KG893_RS02970 (576618) | 576618..577295 | + | 678 | Protein_570 | DNA topoisomerase | - |
KG893_RS14850 (577606) | 577606..578103 | + | 498 | WP_002327635.1 | DNA recombinase | - |
KG893_RS02985 (578104) | 578104..578520 | + | 417 | WP_000323438.1 | recombinase | - |
KG893_RS02990 (578540) | 578540..580084 | + | 1545 | WP_002390960.1 | recombinase family protein | - |
KG893_RS02995 (580227) | 580227..580451 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
KG893_RS03000 (580466) | 580466..581335 | + | 870 | WP_029170889.1 | nucleotidyltransferase domain-containing protein | Toxin |
KG893_RS03005 (581316) | 581316..582050 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
KG893_RS03010 (582083) | 582083..582991 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
KG893_RS03015 (582988) | 582988..583468 | + | 481 | Protein_578 | GNAT family N-acetyltransferase | - |
KG893_RS03020 (583561) | 583561..584355 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
KG893_RS03030 (584897) | 584897..584980 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
KG893_RS03035 (585105) | 585105..585842 | + | 738 | WP_001038790.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 575543..576223 | 680 | |
- | flank | IS/Tn | ant(6)-Ia / aph(3')-III / erm(B) | - | 582083..590605 | 8522 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32820.25 Da Isoelectric Point: 4.9564
>T294589 WP_029170889.1 NZ_OD940440:580466-581335 [Enterococcus faecalis]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIMKDTEHGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAETY
PNALQKSLVNFFMFEAGFSLMFVKANSGTDDKYYIAGHVFRIVSCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIMKDTEHGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAETY
PNALQKSLVNFFMFEAGFSLMFVKANSGTDDKYYIAGHVFRIVSCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|