Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 432128..432710 | Replicon | chromosome |
| Accession | NZ_OD940440 | ||
| Organism | Enterococcus faecalis isolate WE0254 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | A0A0M2AE74 |
| Locus tag | KG893_RS02265 | Protein ID | WP_002355414.1 |
| Coordinates | 432402..432710 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | KG893_RS02260 | Protein ID | WP_002326825.1 |
| Coordinates | 432128..432400 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KG893_RS02230 (427409) | 427409..428137 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
| KG893_RS02235 (428314) | 428314..429240 | + | 927 | WP_002355406.1 | hypothetical protein | - |
| KG893_RS02240 (429257) | 429257..430540 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
| KG893_RS02245 (430732) | 430732..430854 | + | 123 | Protein_421 | topoisomerase | - |
| KG893_RS02250 (430929) | 430929..431825 | + | 897 | WP_002363034.1 | ParA family protein | - |
| KG893_RS02255 (431902) | 431902..432111 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
| KG893_RS02260 (432128) | 432128..432400 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| KG893_RS02265 (432402) | 432402..432710 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
| KG893_RS02270 (432790) | 432790..433212 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
| KG893_RS02275 (433263) | 433263..433763 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
| KG893_RS02280 (433768) | 433768..434535 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| KG893_RS02285 (435023) | 435023..435448 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
| KG893_RS02290 (435465) | 435465..435980 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
| KG893_RS02295 (435991) | 435991..436923 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 414192..447458 | 33266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T294586 WP_002355414.1 NZ_OD940440:432402-432710 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AE74 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |