Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 33712..34283 Replicon plasmid contig000003
Accession NZ_OD940439
Organism Enterococcus faecalis isolate BX8117

Toxin (Protein)


Gene name mazF Uniprot ID A0A2P6BPI5
Locus tag KJA90_RS14545 Protein ID WP_002394791.1
Coordinates 33712..34053 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag KJA90_RS14550 Protein ID WP_002362431.1
Coordinates 34053..34283 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJA90_RS14515 (BX8117_02952) 28882..29562 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
KJA90_RS14520 (BX8117_02953) 29838..30572 - 735 Protein_30 ISNCY family transposase -
KJA90_RS14525 (BX8117_02954) 30628..31308 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
KJA90_RS14530 31385..31558 + 174 Protein_32 IS6 family transposase -
KJA90_RS14535 (BX8117_02955) 31792..32394 - 603 WP_002367780.1 Fic family protein -
KJA90_RS14540 (BX8117_02956) 32662..33600 - 939 WP_002394789.1 hypothetical protein -
KJA90_RS14545 (BX8117_02957) 33712..34053 - 342 WP_002394791.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
KJA90_RS14550 (BX8117_02958) 34053..34283 - 231 WP_002362431.1 hypothetical protein Antitoxin
KJA90_RS14555 (BX8117_02959) 34487..35107 + 621 WP_002367784.1 recombinase family protein -
KJA90_RS14560 (BX8117_02960) 35097..35411 + 315 WP_002367785.1 hypothetical protein -
KJA90_RS14770 (BX8117_02961) 35405..35611 + 207 WP_002367786.1 hypothetical protein -
KJA90_RS14565 (BX8117_02962) 35771..35965 + 195 WP_002367787.1 hypothetical protein -
KJA90_RS14570 (BX8117_02963) 35977..36168 + 192 WP_002367788.1 hypothetical protein -
KJA90_RS14575 (BX8117_02964) 36338..36553 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
KJA90_RS14580 (BX8117_02965) 36554..36895 + 342 WP_002367792.1 bacteriocin immunity protein -
KJA90_RS14585 (BX8117_02966) 37311..37829 + 519 WP_002367793.1 hypothetical protein -
KJA90_RS14775 (BX8117_02967) 37777..37992 + 216 WP_002415356.1 hypothetical protein -
KJA90_RS14590 38084..38170 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
KJA90_RS14595 (BX8117_02968) 38427..38723 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid cat / Cfr(D) / optrA / fexA - 1..41839 41839


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13248.49 Da        Isoelectric Point: 8.8595

>T294585 WP_002394791.1 NZ_OD940439:c34053-33712 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT294585 WP_002362431.1 NZ_OD940439:c34283-34053 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P6BPI5

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References