Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 1524108..1525245 | Replicon | chromosome |
Accession | NZ_OD940437 | ||
Organism | Enterococcus faecalis isolate BX8117 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | KJA90_RS07350 | Protein ID | WP_002401483.1 |
Coordinates | 1524108..1524971 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | KJA90_RS07355 | Protein ID | WP_000301765.1 |
Coordinates | 1524973..1525245 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA90_RS07320 (1520024) | 1520024..1520791 | - | 768 | WP_002357481.1 | ribonuclease HII | - |
KJA90_RS07325 (1520793) | 1520793..1521644 | - | 852 | WP_002357480.1 | ribosome biogenesis GTPase YlqF | - |
KJA90_RS07330 (1521920) | 1521920..1522234 | - | 315 | Protein_1417 | ketopantoate reductase C-terminal domain-containing protein | - |
KJA90_RS07335 (1522289) | 1522289..1522969 | - | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
KJA90_RS07340 (1523043) | 1523043..1523330 | - | 288 | Protein_1419 | DnaJ domain-containing protein | - |
KJA90_RS07345 (1523350) | 1523350..1523667 | - | 318 | WP_002333463.1 | hypothetical protein | - |
KJA90_RS07350 (1524108) | 1524108..1524971 | - | 864 | WP_002401483.1 | zeta toxin family protein | Toxin |
KJA90_RS07355 (1524973) | 1524973..1525245 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
KJA90_RS07360 (1525262) | 1525262..1525477 | - | 216 | WP_002295735.1 | peptide-binding protein | - |
KJA90_RS07365 (1525576) | 1525576..1526472 | - | 897 | WP_002387620.1 | ParA family protein | - |
KJA90_RS07370 (1526575) | 1526575..1526835 | - | 261 | Protein_1425 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
KJA90_RS07375 (1527005) | 1527005..1527742 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
KJA90_RS07380 (1527867) | 1527867..1527962 | - | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
KJA90_RS07385 (1528031) | 1528031..1528153 | - | 123 | Protein_1428 | peptide-binding protein | - |
KJA90_RS07390 (1528273) | 1528273..1529949 | - | 1677 | WP_002346508.1 | type IA DNA topoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | erm(B) / cat / str | - | 1522289..1535513 | 13224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32486.06 Da Isoelectric Point: 6.9965
>T294572 WP_002401483.1 NZ_OD940437:c1524971-1524108 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|