294569

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 396961..397495 Replicon chromosome
Accession NZ_OD940437
Organism Enterococcus faecalis isolate BX8117

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag KJA90_RS02010 Protein ID WP_002360769.1
Coordinates 397220..397495 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag KJA90_RS02005 Protein ID WP_002369771.1
Coordinates 396961..397227 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJA90_RS01970 (393011) 393011..393604 + 594 WP_002414802.1 replication-relaxation family protein -
KJA90_RS01975 (393610) 393610..394098 + 489 WP_010710133.1 hypothetical protein -
KJA90_RS01980 (394690) 394690..394956 + 267 WP_002377947.1 hypothetical protein -
KJA90_RS01985 (394989) 394989..395489 + 501 WP_002360775.1 DnaJ domain-containing protein -
KJA90_RS01990 (395502) 395502..395750 + 249 WP_002360773.1 DUF3850 domain-containing protein -
KJA90_RS01995 (395826) 395826..396242 + 417 WP_010710134.1 single-stranded DNA-binding protein -
KJA90_RS02000 (396266) 396266..396850 + 585 WP_002377949.1 thermonuclease family protein -
KJA90_RS02005 (396961) 396961..397227 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
KJA90_RS02010 (397220) 397220..397495 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
KJA90_RS02015 (397686) 397686..398330 - 645 WP_002377952.1 IS6 family transposase -
KJA90_RS02020 (398463) 398463..399345 + 883 Protein_376 IS256 family transposase -
KJA90_RS02025 (399650) 399650..400687 - 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
KJA90_RS02030 (400713) 400713..401651 - 939 WP_002370935.1 2-dehydropantoate 2-reductase -
KJA90_RS02035 (401779) 401779..402108 - 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
KJA90_RS02040 (402138) 402138..402323 + 186 WP_002358660.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - bsh / cylR2 / cylR1 / cylL / cylS / cylM / cylB / cylA / cylI / esp 375871..435016 59145


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T294569 WP_002360769.1 NZ_OD940437:397220-397495 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT294569 WP_002369771.1 NZ_OD940437:396961-397227 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References