Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 42005..42576 Replicon plasmid contig000003
Accession NZ_OD940436
Organism Enterococcus faecalis isolate BX5936

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag KJA96_RS14015 Protein ID WP_002362432.1
Coordinates 42005..42346 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag KJA96_RS14020 Protein ID WP_002362431.1
Coordinates 42346..42576 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJA96_RS13995 (BX5936_02863) 37506..38354 + 849 WP_001258486.1 streptomycin adenylyltransferase Str -
KJA96_RS14005 (BX5936_02866) 40088..40690 - 603 WP_002362434.1 Fic family protein -
KJA96_RS14010 (BX5936_02867) 40955..41893 - 939 WP_002362433.1 hypothetical protein -
KJA96_RS14015 (BX5936_02868) 42005..42346 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
KJA96_RS14020 (BX5936_02869) 42346..42576 - 231 WP_002362431.1 hypothetical protein Antitoxin
KJA96_RS14025 (BX5936_02870) 42780..43400 + 621 WP_002367784.1 recombinase family protein -
KJA96_RS14030 (BX5936_02871) 43390..43704 + 315 WP_002367785.1 hypothetical protein -
KJA96_RS14250 (BX5936_02872) 43698..43904 + 207 WP_002367786.1 hypothetical protein -
KJA96_RS14035 (BX5936_02873) 44064..44258 + 195 WP_002367787.1 hypothetical protein -
KJA96_RS14040 (BX5936_02874) 44270..44461 + 192 WP_002367788.1 hypothetical protein -
KJA96_RS14045 (BX5936_02875) 44631..44846 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
KJA96_RS14050 (BX5936_02876) 44847..45188 + 342 WP_002367792.1 bacteriocin immunity protein -
KJA96_RS14055 (BX5936_02877) 45604..46122 + 519 WP_002367793.1 hypothetical protein -
KJA96_RS14255 46070..46285 + 216 WP_002415356.1 hypothetical protein -
KJA96_RS14060 46377..46463 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
KJA96_RS14065 (BX5936_02878) 46720..47016 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / str / erm(B) - 1..51669 51669


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T294567 WP_002362432.1 NZ_OD940436:c42346-42005 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT294567 WP_002362431.1 NZ_OD940436:c42576-42346 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References