Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 42005..42576 | Replicon | plasmid contig000003 |
Accession | NZ_OD940436 | ||
Organism | Enterococcus faecalis isolate BX5936 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
Locus tag | KJA96_RS14015 | Protein ID | WP_002362432.1 |
Coordinates | 42005..42346 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3KHK9 |
Locus tag | KJA96_RS14020 | Protein ID | WP_002362431.1 |
Coordinates | 42346..42576 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA96_RS13995 (BX5936_02863) | 37506..38354 | + | 849 | WP_001258486.1 | streptomycin adenylyltransferase Str | - |
KJA96_RS14005 (BX5936_02866) | 40088..40690 | - | 603 | WP_002362434.1 | Fic family protein | - |
KJA96_RS14010 (BX5936_02867) | 40955..41893 | - | 939 | WP_002362433.1 | hypothetical protein | - |
KJA96_RS14015 (BX5936_02868) | 42005..42346 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
KJA96_RS14020 (BX5936_02869) | 42346..42576 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
KJA96_RS14025 (BX5936_02870) | 42780..43400 | + | 621 | WP_002367784.1 | recombinase family protein | - |
KJA96_RS14030 (BX5936_02871) | 43390..43704 | + | 315 | WP_002367785.1 | hypothetical protein | - |
KJA96_RS14250 (BX5936_02872) | 43698..43904 | + | 207 | WP_002367786.1 | hypothetical protein | - |
KJA96_RS14035 (BX5936_02873) | 44064..44258 | + | 195 | WP_002367787.1 | hypothetical protein | - |
KJA96_RS14040 (BX5936_02874) | 44270..44461 | + | 192 | WP_002367788.1 | hypothetical protein | - |
KJA96_RS14045 (BX5936_02875) | 44631..44846 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
KJA96_RS14050 (BX5936_02876) | 44847..45188 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
KJA96_RS14055 (BX5936_02877) | 45604..46122 | + | 519 | WP_002367793.1 | hypothetical protein | - |
KJA96_RS14255 | 46070..46285 | + | 216 | WP_002415356.1 | hypothetical protein | - |
KJA96_RS14060 | 46377..46463 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
KJA96_RS14065 (BX5936_02878) | 46720..47016 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | cat / tet(L) / tet(M) / str / erm(B) | - | 1..51669 | 51669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T294567 WP_002362432.1 NZ_OD940436:c42346-42005 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R3KHK9 |