Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2690407..2690978 | Replicon | chromosome |
Accession | NZ_OD940434 | ||
Organism | Enterococcus faecalis isolate BX5936 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | KJA96_RS12945 | Protein ID | WP_002354774.1 |
Coordinates | 2690407..2690748 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | KJA96_RS12950 | Protein ID | WP_002354773.1 |
Coordinates | 2690748..2690978 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA96_RS12940 (2686422) | 2686422..2690036 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
KJA96_RS12945 (2690407) | 2690407..2690748 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
KJA96_RS12950 (2690748) | 2690748..2690978 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
KJA96_RS12955 (2691392) | 2691392..2691607 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
KJA96_RS12960 (2691746) | 2691746..2692738 | + | 993 | WP_002365428.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
KJA96_RS12965 (2692805) | 2692805..2693437 | - | 633 | WP_002358972.1 | RloB family protein | - |
KJA96_RS12970 (2693446) | 2693446..2694741 | - | 1296 | WP_010820355.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T294562 WP_002354774.1 NZ_OD940434:c2690748-2690407 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|