Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/Peptidase_M78-HTH_26
Location 1768340..1769038 Replicon chromosome
Accession NZ_OD940434
Organism Enterococcus faecalis isolate BX5936

Toxin (Protein)


Gene name IrrE Uniprot ID A0A828QMF1
Locus tag KJA96_RS08745 Protein ID WP_002388207.1
Coordinates 1768694..1769038 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag KJA96_RS08740 Protein ID WP_002388206.1
Coordinates 1768340..1768675 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJA96_RS08695 (1763806) 1763806..1764123 - 318 WP_002357007.1 hypothetical protein -
KJA96_RS08700 (1764343) 1764343..1764897 + 555 WP_002357006.1 hypothetical protein -
KJA96_RS08705 (1765182) 1765182..1765520 - 339 WP_002357003.1 hypothetical protein -
KJA96_RS08710 (1765557) 1765557..1765766 - 210 WP_002357002.1 hypothetical protein -
KJA96_RS08715 (1765821) 1765821..1766009 + 189 WP_002357001.1 YegP family protein -
KJA96_RS08720 (1766035) 1766035..1766757 - 723 WP_002357000.1 phage regulatory protein -
KJA96_RS08725 (1766780) 1766780..1767091 - 312 WP_002381719.1 hypothetical protein -
KJA96_RS08730 (1767688) 1767688..1767885 - 198 WP_010712611.1 hypothetical protein -
KJA96_RS08735 (1767898) 1767898..1768080 - 183 WP_002388205.1 hypothetical protein -
KJA96_RS08740 (1768340) 1768340..1768675 + 336 WP_002388206.1 helix-turn-helix transcriptional regulator Antitoxin
KJA96_RS08745 (1768694) 1768694..1769038 + 345 WP_002388207.1 ImmA/IrrE family metallo-endopeptidase Toxin
KJA96_RS14205 (1769096) 1769096..1769224 + 129 Protein_1705 ion transporter -
KJA96_RS08750 (1769276) 1769276..1770448 - 1173 WP_002323245.1 IS256-like element IS1542 family transposase -
KJA96_RS08755 (1770557) 1770557..1771156 + 600 WP_283669868.1 potassium channel family protein -
KJA96_RS08760 (1771256) 1771256..1772404 + 1149 WP_002388210.1 site-specific integrase -
KJA96_RS08765 (1772432) 1772432..1772875 - 444 WP_002388212.1 competence type IV pilus minor pilin ComGD -
KJA96_RS08770 (1772872) 1772872..1773147 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1731270..1791252 59982
- flank IS/Tn - - 1769276..1770448 1172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(21-86)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-60)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13625.58 Da        Isoelectric Point: 4.9570

>T294559 WP_002388207.1 NZ_OD940434:1768694-1769038 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPTEQEEAIYHELKHVEDHVDIMALYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12842.51 Da        Isoelectric Point: 5.2926

>AT294559 WP_002388206.1 NZ_OD940434:1768340-1768675 [Enterococcus faecalis]
MTVFDRIKLLAKERGKSLNRIEEELGLPKNVLYRMKTSDNPTKDRLETLANYFDVSVDYLLGRTDNTKATDEKKSDDLDD
VLDNVMSFDGKPLDDHDREVIRAYLKGRFGK

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828QMF1

Antitoxin

Source ID Structure

References