Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/Peptidase_M78-HTH_26 |
| Location | 1768340..1769038 | Replicon | chromosome |
| Accession | NZ_OD940434 | ||
| Organism | Enterococcus faecalis isolate BX5936 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | A0A828QMF1 |
| Locus tag | KJA96_RS08745 | Protein ID | WP_002388207.1 |
| Coordinates | 1768694..1769038 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | KJA96_RS08740 | Protein ID | WP_002388206.1 |
| Coordinates | 1768340..1768675 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA96_RS08695 (1763806) | 1763806..1764123 | - | 318 | WP_002357007.1 | hypothetical protein | - |
| KJA96_RS08700 (1764343) | 1764343..1764897 | + | 555 | WP_002357006.1 | hypothetical protein | - |
| KJA96_RS08705 (1765182) | 1765182..1765520 | - | 339 | WP_002357003.1 | hypothetical protein | - |
| KJA96_RS08710 (1765557) | 1765557..1765766 | - | 210 | WP_002357002.1 | hypothetical protein | - |
| KJA96_RS08715 (1765821) | 1765821..1766009 | + | 189 | WP_002357001.1 | YegP family protein | - |
| KJA96_RS08720 (1766035) | 1766035..1766757 | - | 723 | WP_002357000.1 | phage regulatory protein | - |
| KJA96_RS08725 (1766780) | 1766780..1767091 | - | 312 | WP_002381719.1 | hypothetical protein | - |
| KJA96_RS08730 (1767688) | 1767688..1767885 | - | 198 | WP_010712611.1 | hypothetical protein | - |
| KJA96_RS08735 (1767898) | 1767898..1768080 | - | 183 | WP_002388205.1 | hypothetical protein | - |
| KJA96_RS08740 (1768340) | 1768340..1768675 | + | 336 | WP_002388206.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| KJA96_RS08745 (1768694) | 1768694..1769038 | + | 345 | WP_002388207.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| KJA96_RS14205 (1769096) | 1769096..1769224 | + | 129 | Protein_1705 | ion transporter | - |
| KJA96_RS08750 (1769276) | 1769276..1770448 | - | 1173 | WP_002323245.1 | IS256-like element IS1542 family transposase | - |
| KJA96_RS08755 (1770557) | 1770557..1771156 | + | 600 | WP_283669868.1 | potassium channel family protein | - |
| KJA96_RS08760 (1771256) | 1771256..1772404 | + | 1149 | WP_002388210.1 | site-specific integrase | - |
| KJA96_RS08765 (1772432) | 1772432..1772875 | - | 444 | WP_002388212.1 | competence type IV pilus minor pilin ComGD | - |
| KJA96_RS08770 (1772872) | 1772872..1773147 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1731270..1791252 | 59982 | |
| - | flank | IS/Tn | - | - | 1769276..1770448 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13625.58 Da Isoelectric Point: 4.9570
>T294559 WP_002388207.1 NZ_OD940434:1768694-1769038 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPTEQEEAIYHELKHVEDHVDIMALYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPTEQEEAIYHELKHVEDHVDIMALYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|