Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 416017..416599 | Replicon | chromosome |
Accession | NZ_OD940434 | ||
Organism | Enterococcus faecalis isolate BX5936 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | KJA96_RS02150 | Protein ID | WP_002355414.1 |
Coordinates | 416291..416599 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | KJA96_RS02145 | Protein ID | WP_002326825.1 |
Coordinates | 416017..416289 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA96_RS02115 (411298) | 411298..412026 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
KJA96_RS02120 (412203) | 412203..413129 | + | 927 | WP_002355406.1 | hypothetical protein | - |
KJA96_RS02125 (413146) | 413146..414429 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
KJA96_RS02130 (414621) | 414621..414743 | + | 123 | Protein_396 | topoisomerase | - |
KJA96_RS02135 (414818) | 414818..415714 | + | 897 | WP_002363034.1 | ParA family protein | - |
KJA96_RS02140 (415791) | 415791..416000 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
KJA96_RS02145 (416017) | 416017..416289 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
KJA96_RS02150 (416291) | 416291..416599 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
KJA96_RS02155 (416679) | 416679..417101 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
KJA96_RS02160 (417152) | 417152..417652 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
KJA96_RS02165 (417657) | 417657..418424 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
KJA96_RS02170 (418912) | 418912..419337 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
KJA96_RS02175 (419354) | 419354..419869 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
KJA96_RS02180 (419880) | 419880..420812 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T294556 WP_002355414.1 NZ_OD940434:416291-416599 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |