Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 69414..70551 Replicon plasmid contig000002
Accession NZ_OD940432
Organism Enterococcus faecalis isolate TM6294

Toxin (Protein)


Gene name zeta Uniprot ID P0A4M2
Locus tag KJA93_RS13760 Protein ID WP_002332783.1
Coordinates 69414..70277 (-) Length 288 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag KJA93_RS13765 Protein ID WP_002326825.1
Coordinates 70279..70551 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJA93_RS13715 64654..64764 - 111 Protein_79 aminoglycoside 6-adenylyltransferase -
KJA93_RS13720 64783..64899 - 117 Protein_80 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
KJA93_RS13725 (TM6294_02803) 65069..65806 - 738 WP_002292226.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
KJA93_RS13730 65931..66014 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
KJA93_RS13735 (TM6294_02804) 66137..66304 - 168 Protein_83 peptide-binding protein -
KJA93_RS13740 (TM6294_02805) 66438..67064 - 627 Protein_84 DNA topoisomerase -
KJA93_RS13745 (TM6294_02806) 67140..67820 + 681 WP_010710189.1 IS6-like element IS1216 family transposase -
KJA93_RS13750 (TM6294_02807) 67854..68360 - 507 WP_002415429.1 trimethoprim-resistant dihydrofolate reductase DfrG -
KJA93_RS13755 (TM6294_02808) 68657..68974 - 318 WP_002326830.1 hypothetical protein -
KJA93_RS13760 (TM6294_02809) 69414..70277 - 864 WP_002332783.1 zeta toxin family protein Toxin
KJA93_RS13765 (TM6294_02810) 70279..70551 - 273 WP_002326825.1 antitoxin Antitoxin
KJA93_RS13770 (TM6294_02811) 70569..70784 - 216 WP_001835296.1 peptide-binding protein -
KJA93_RS13775 (TM6294_02812) 70876..71772 - 897 WP_002326827.1 ParA family protein -
KJA93_RS13780 71875..72135 - 261 Protein_92 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
KJA93_RS13785 (TM6294_02813) 72305..73042 - 738 WP_001038795.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
KJA93_RS13790 73167..73250 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
KJA93_RS14205 73299..73382 - 84 Protein_95 MLS leader peptide -
KJA93_RS13795 (TM6294_02814) 73682..74053 - 372 WP_126254895.1 Replication-associated protein RepC -
KJA93_RS13800 (TM6294_02815) 74046..74891 - 846 WP_000239313.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / str / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG - 1..75362 75362
- inside IS/Tn erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG - 48632..73042 24410


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(28-214)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 288 a.a.        Molecular weight: 32675.27 Da        Isoelectric Point: 7.3939

>T294550 WP_002332783.1 NZ_OD940432:c70277-69414 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI

Download         Length: 864 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT294550 WP_002326825.1 NZ_OD940432:c70551-70279 [Enterococcus faecalis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P0A4M2

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References