Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 69414..70551 | Replicon | plasmid contig000002 |
| Accession | NZ_OD940432 | ||
| Organism | Enterococcus faecalis isolate TM6294 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | P0A4M2 |
| Locus tag | KJA93_RS13760 | Protein ID | WP_002332783.1 |
| Coordinates | 69414..70277 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | KJA93_RS13765 | Protein ID | WP_002326825.1 |
| Coordinates | 70279..70551 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA93_RS13715 | 64654..64764 | - | 111 | Protein_79 | aminoglycoside 6-adenylyltransferase | - |
| KJA93_RS13720 | 64783..64899 | - | 117 | Protein_80 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| KJA93_RS13725 (TM6294_02803) | 65069..65806 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| KJA93_RS13730 | 65931..66014 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| KJA93_RS13735 (TM6294_02804) | 66137..66304 | - | 168 | Protein_83 | peptide-binding protein | - |
| KJA93_RS13740 (TM6294_02805) | 66438..67064 | - | 627 | Protein_84 | DNA topoisomerase | - |
| KJA93_RS13745 (TM6294_02806) | 67140..67820 | + | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
| KJA93_RS13750 (TM6294_02807) | 67854..68360 | - | 507 | WP_002415429.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
| KJA93_RS13755 (TM6294_02808) | 68657..68974 | - | 318 | WP_002326830.1 | hypothetical protein | - |
| KJA93_RS13760 (TM6294_02809) | 69414..70277 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
| KJA93_RS13765 (TM6294_02810) | 70279..70551 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| KJA93_RS13770 (TM6294_02811) | 70569..70784 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
| KJA93_RS13775 (TM6294_02812) | 70876..71772 | - | 897 | WP_002326827.1 | ParA family protein | - |
| KJA93_RS13780 | 71875..72135 | - | 261 | Protein_92 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| KJA93_RS13785 (TM6294_02813) | 72305..73042 | - | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| KJA93_RS13790 | 73167..73250 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| KJA93_RS14205 | 73299..73382 | - | 84 | Protein_95 | MLS leader peptide | - |
| KJA93_RS13795 (TM6294_02814) | 73682..74053 | - | 372 | WP_126254895.1 | Replication-associated protein RepC | - |
| KJA93_RS13800 (TM6294_02815) | 74046..74891 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / str / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 1..75362 | 75362 | |
| - | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 48632..73042 | 24410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T294550 WP_002332783.1 NZ_OD940432:c70277-69414 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P0A4M2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |