Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 53201..54309 | Replicon | plasmid contig000002 |
Accession | NZ_OD940432 | ||
Organism | Enterococcus faecalis isolate TM6294 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | - |
Locus tag | KJA93_RS13650 | Protein ID | WP_078126936.1 |
Coordinates | 53201..54070 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | B9DSK1 |
Locus tag | KJA93_RS13655 | Protein ID | WP_002303393.1 |
Coordinates | 54085..54309 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA93_RS13620 (TM6294_02784) | 48632..49369 | - | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
KJA93_RS13625 | 49494..49577 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
KJA93_RS14200 | 49626..49709 | - | 84 | Protein_61 | MLS leader peptide | - |
KJA93_RS13630 (TM6294_02785) | 50119..50913 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
KJA93_RS13635 (TM6294_02786) | 51006..51548 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
KJA93_RS13640 (TM6294_02787) | 51545..52453 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
KJA93_RS13645 (TM6294_02788) | 52486..53220 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
KJA93_RS13650 (TM6294_02789) | 53201..54070 | - | 870 | WP_078126936.1 | nucleotidyltransferase domain-containing protein | Toxin |
KJA93_RS13655 (TM6294_02790) | 54085..54309 | - | 225 | WP_002303393.1 | helix-turn-helix transcriptional regulator | Antitoxin |
KJA93_RS13660 (TM6294_02791) | 54452..55273 | - | 822 | Protein_68 | recombinase zinc beta ribbon domain-containing protein | - |
KJA93_RS13665 (TM6294_02792) | 55961..56764 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
KJA93_RS13670 (TM6294_02793) | 56818..58302 | - | 1485 | WP_213044579.1 | Lsa family ABC-F type ribosomal protection protein | - |
KJA93_RS13675 (TM6294_02794) | 58745..59308 | - | 564 | Protein_71 | recombinase zinc beta ribbon domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | cat / tet(L) / tet(M) / str / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 1..75362 | 75362 | |
- | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 48632..73042 | 24410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32835.43 Da Isoelectric Point: 4.7269
>T294549 WP_078126936.1 NZ_OD940432:c54070-53201 [Enterococcus faecalis]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARSTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARSTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|