Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Xre-MNT/HTH_26(antitoxin)
Location 53201..54309 Replicon plasmid contig000002
Accession NZ_OD940432
Organism Enterococcus faecalis isolate TM6294

Toxin (Protein)


Gene name MNTss Uniprot ID -
Locus tag KJA93_RS13650 Protein ID WP_078126936.1
Coordinates 53201..54070 (-) Length 290 a.a.

Antitoxin (Protein)


Gene name Xress Uniprot ID B9DSK1
Locus tag KJA93_RS13655 Protein ID WP_002303393.1
Coordinates 54085..54309 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJA93_RS13620 (TM6294_02784) 48632..49369 - 738 WP_001038795.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
KJA93_RS13625 49494..49577 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
KJA93_RS14200 49626..49709 - 84 Protein_61 MLS leader peptide -
KJA93_RS13630 (TM6294_02785) 50119..50913 - 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
KJA93_RS13635 (TM6294_02786) 51006..51548 - 543 WP_000627290.1 streptothricin N-acetyltransferase Sat4 -
KJA93_RS13640 (TM6294_02787) 51545..52453 - 909 WP_001255866.1 aminoglycoside nucleotidyltransferase ANT(6)-Ia -
KJA93_RS13645 (TM6294_02788) 52486..53220 - 735 WP_000662263.1 class I SAM-dependent methyltransferase -
KJA93_RS13650 (TM6294_02789) 53201..54070 - 870 WP_078126936.1 nucleotidyltransferase domain-containing protein Toxin
KJA93_RS13655 (TM6294_02790) 54085..54309 - 225 WP_002303393.1 helix-turn-helix transcriptional regulator Antitoxin
KJA93_RS13660 (TM6294_02791) 54452..55273 - 822 Protein_68 recombinase zinc beta ribbon domain-containing protein -
KJA93_RS13665 (TM6294_02792) 55961..56764 - 804 WP_002294514.1 lincosamide nucleotidyltransferase Lnu(B) -
KJA93_RS13670 (TM6294_02793) 56818..58302 - 1485 WP_213044579.1 Lsa family ABC-F type ribosomal protection protein -
KJA93_RS13675 (TM6294_02794) 58745..59308 - 564 Protein_71 recombinase zinc beta ribbon domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / str / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG - 1..75362 75362
- inside IS/Tn erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG - 48632..73042 24410


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Polymerase, nucleotidyl transferase domain

(12-111)

Antitoxin

Cro/C1-type helix-turn-helix domain

(4-57)


Sequences

Toxin        


Download         Length: 290 a.a.        Molecular weight: 32835.43 Da        Isoelectric Point: 4.7269

>T294549 WP_078126936.1 NZ_OD940432:c54070-53201 [Enterococcus faecalis]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARSTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI

Download         Length: 870 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8351.65 Da        Isoelectric Point: 4.5357

>AT294549 WP_002303393.1 NZ_OD940432:c54309-54085 [Enterococcus faecalis]
MTTAEMIKELCEQMNISVSELARRIGQTPQNFNKKLQRETVTLDELKAIADVLGVKFVQAFILPDGDEIKISNE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1M5SHM7

References