Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 42025..42596 Replicon plasmid contig000002
Accession NZ_OD940432
Organism Enterococcus faecalis isolate TM6294

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag KJA93_RS13560 Protein ID WP_002362432.1
Coordinates 42025..42366 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag KJA93_RS13565 Protein ID WP_002362431.1
Coordinates 42366..42596 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJA93_RS13540 (TM6294_02767) 37526..38374 + 849 WP_126254908.1 streptomycin adenylyltransferase Str -
KJA93_RS13550 (TM6294_02770) 40108..40710 - 603 WP_002362434.1 Fic family protein -
KJA93_RS13555 (TM6294_02771) 40975..41913 - 939 WP_002362433.1 hypothetical protein -
KJA93_RS13560 (TM6294_02772) 42025..42366 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
KJA93_RS13565 (TM6294_02773) 42366..42596 - 231 WP_002362431.1 hypothetical protein Antitoxin
KJA93_RS13570 (TM6294_02774) 42800..43420 + 621 WP_002367784.1 recombinase family protein -
KJA93_RS13575 (TM6294_02775) 43410..43724 + 315 WP_002367785.1 hypothetical protein -
KJA93_RS14155 (TM6294_02776) 43718..43924 + 207 WP_002367786.1 hypothetical protein -
KJA93_RS13580 (TM6294_02777) 44084..44278 + 195 WP_002367787.1 hypothetical protein -
KJA93_RS13585 (TM6294_02778) 44290..44481 + 192 WP_002367788.1 hypothetical protein -
KJA93_RS13590 (TM6294_02779) 44651..44866 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
KJA93_RS13595 (TM6294_02780) 44867..45208 + 342 WP_002367792.1 bacteriocin immunity protein -
KJA93_RS13600 (TM6294_02781) 45624..46142 + 519 WP_002367793.1 hypothetical protein -
KJA93_RS14160 46090..46305 + 216 WP_002415356.1 hypothetical protein -
KJA93_RS13605 46397..46483 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
KJA93_RS13610 (TM6294_02782) 46740..47036 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / str / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG - 1..75362 75362


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T294548 WP_002362432.1 NZ_OD940432:c42366-42025 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT294548 WP_002362431.1 NZ_OD940432:c42596-42366 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References