Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 42025..42596 | Replicon | plasmid contig000002 |
| Accession | NZ_OD940432 | ||
| Organism | Enterococcus faecalis isolate TM6294 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | KJA93_RS13560 | Protein ID | WP_002362432.1 |
| Coordinates | 42025..42366 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | KJA93_RS13565 | Protein ID | WP_002362431.1 |
| Coordinates | 42366..42596 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA93_RS13540 (TM6294_02767) | 37526..38374 | + | 849 | WP_126254908.1 | streptomycin adenylyltransferase Str | - |
| KJA93_RS13550 (TM6294_02770) | 40108..40710 | - | 603 | WP_002362434.1 | Fic family protein | - |
| KJA93_RS13555 (TM6294_02771) | 40975..41913 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| KJA93_RS13560 (TM6294_02772) | 42025..42366 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| KJA93_RS13565 (TM6294_02773) | 42366..42596 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| KJA93_RS13570 (TM6294_02774) | 42800..43420 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| KJA93_RS13575 (TM6294_02775) | 43410..43724 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| KJA93_RS14155 (TM6294_02776) | 43718..43924 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| KJA93_RS13580 (TM6294_02777) | 44084..44278 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| KJA93_RS13585 (TM6294_02778) | 44290..44481 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| KJA93_RS13590 (TM6294_02779) | 44651..44866 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| KJA93_RS13595 (TM6294_02780) | 44867..45208 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| KJA93_RS13600 (TM6294_02781) | 45624..46142 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| KJA93_RS14160 | 46090..46305 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| KJA93_RS13605 | 46397..46483 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| KJA93_RS13610 (TM6294_02782) | 46740..47036 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / str / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 1..75362 | 75362 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T294548 WP_002362432.1 NZ_OD940432:c42366-42025 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |