Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2701270..2701841 | Replicon | chromosome |
Accession | NZ_OD940431 | ||
Organism | Enterococcus faecalis isolate TM6294 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | KJA93_RS12880 | Protein ID | WP_002396016.1 |
Coordinates | 2701270..2701611 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S4CGQ1 |
Locus tag | KJA93_RS12885 | Protein ID | WP_002367500.1 |
Coordinates | 2701611..2701841 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA93_RS12875 (2697285) | 2697285..2700899 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
KJA93_RS12880 (2701270) | 2701270..2701611 | - | 342 | WP_002396016.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
KJA93_RS12885 (2701611) | 2701611..2701841 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
KJA93_RS12890 (2702254) | 2702254..2702469 | - | 216 | WP_213044572.1 | zinc ribbon domain-containing protein | - |
KJA93_RS12895 (2702608) | 2702608..2703600 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
KJA93_RS12900 (2703767) | 2703767..2704405 | - | 639 | WP_126254829.1 | lytic polysaccharide monooxygenase | - |
KJA93_RS12905 (2705092) | 2705092..2706708 | + | 1617 | WP_126254830.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.46 Da Isoelectric Point: 9.4141
>T294541 WP_002396016.1 NZ_OD940431:c2701611-2701270 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQQRRLGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDVIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQQRRLGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDVIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|