Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 406725..407259 Replicon chromosome
Accession NZ_OD940431
Organism Enterococcus faecalis isolate TM6294

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag KJA93_RS02065 Protein ID WP_002360769.1
Coordinates 406984..407259 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag KJA93_RS02060 Protein ID WP_002369771.1
Coordinates 406725..406991 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJA93_RS02025 (402583) 402583..403368 + 786 WP_002360778.1 replication-relaxation family protein -
KJA93_RS02030 (403374) 403374..403862 + 489 WP_010710133.1 hypothetical protein -
KJA93_RS02035 (404454) 404454..404720 + 267 WP_002377947.1 hypothetical protein -
KJA93_RS02040 (404753) 404753..405253 + 501 WP_002360775.1 DnaJ domain-containing protein -
KJA93_RS02045 (405266) 405266..405514 + 249 WP_002360773.1 DUF3850 domain-containing protein -
KJA93_RS02050 (405590) 405590..406006 + 417 WP_010710134.1 single-stranded DNA-binding protein -
KJA93_RS02055 (406030) 406030..406614 + 585 WP_002377949.1 thermonuclease family protein -
KJA93_RS02060 (406725) 406725..406991 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
KJA93_RS02065 (406984) 406984..407259 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
KJA93_RS02070 (407450) 407450..408094 - 645 WP_002289351.1 IS6 family transposase -
KJA93_RS02075 (408318) 408318..409292 + 975 WP_002355428.1 choloylglycine hydrolase -
KJA93_RS02080 (409961) 409961..410569 - 609 Protein_388 IS6 family transposase -
KJA93_RS02085 (410601) 410601..410786 - 186 WP_002358660.1 hypothetical protein -
KJA93_RS02090 (410816) 410816..411145 + 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
KJA93_RS02095 (411273) 411273..412211 + 939 WP_002370935.1 2-dehydropantoate 2-reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - EF0485 / bsh / cylR2 / cylR1 / cylL / cylS / cylM / cylB / cylA / cylI / esp 381350..486629 105279


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T294532 WP_002360769.1 NZ_OD940431:406984-407259 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT294532 WP_002369771.1 NZ_OD940431:406725-406991 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References