Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 1675379..1675961 | Replicon | chromosome |
| Accession | NZ_OD940422 | ||
| Organism | Enterococcus faecalis isolate WE0851 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | A0A0M2AE74 |
| Locus tag | KJA80_RS07975 | Protein ID | WP_002355414.1 |
| Coordinates | 1675653..1675961 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | KJA80_RS07970 | Protein ID | WP_002326825.1 |
| Coordinates | 1675379..1675651 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA80_RS07940 (1670660) | 1670660..1671388 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
| KJA80_RS07945 (1671565) | 1671565..1672491 | + | 927 | WP_002355406.1 | hypothetical protein | - |
| KJA80_RS07950 (1672508) | 1672508..1673791 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
| KJA80_RS07955 (1673983) | 1673983..1674105 | + | 123 | Protein_1545 | topoisomerase | - |
| KJA80_RS07960 (1674180) | 1674180..1675076 | + | 897 | WP_002363034.1 | ParA family protein | - |
| KJA80_RS07965 (1675153) | 1675153..1675362 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
| KJA80_RS07970 (1675379) | 1675379..1675651 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| KJA80_RS07975 (1675653) | 1675653..1675961 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
| KJA80_RS07980 (1676041) | 1676041..1676463 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
| KJA80_RS07985 (1676514) | 1676514..1677014 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
| KJA80_RS07990 (1677019) | 1677019..1677786 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| KJA80_RS07995 (1678274) | 1678274..1678699 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
| KJA80_RS08000 (1678716) | 1678716..1679231 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
| KJA80_RS08005 (1679242) | 1679242..1680174 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1665186..1677014 | 11828 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T294528 WP_002355414.1 NZ_OD940422:1675653-1675961 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AE74 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |