Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 1166673..1167244 | Replicon | chromosome |
Accession | NZ_OD940422 | ||
Organism | Enterococcus faecalis isolate WE0851 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | KJA80_RS05450 | Protein ID | WP_002360937.1 |
Coordinates | 1166673..1167014 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | KJA80_RS05455 | Protein ID | WP_002354773.1 |
Coordinates | 1167014..1167244 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA80_RS05445 (1162688) | 1162688..1166302 | - | 3615 | WP_010712913.1 | DNA-directed RNA polymerase subunit beta | - |
KJA80_RS05450 (1166673) | 1166673..1167014 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
KJA80_RS05455 (1167014) | 1167014..1167244 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
KJA80_RS05460 (1167418) | 1167418..1167633 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
KJA80_RS05465 (1167772) | 1167772..1168764 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
KJA80_RS05470 (1169028) | 1169028..1169666 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
KJA80_RS05475 (1170353) | 1170353..1171969 | + | 1617 | WP_002415597.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T294524 WP_002360937.1 NZ_OD940422:c1167014-1166673 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A812 |