Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 36945..37516 | Replicon | plasmid contig000002 |
| Accession | NZ_OD940421 | ||
| Organism | Enterococcus faecalis isolate WE0438 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | KJA91_RS14380 | Protein ID | WP_002362432.1 |
| Coordinates | 36945..37286 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | KJA91_RS14385 | Protein ID | WP_002362431.1 |
| Coordinates | 37286..37516 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA91_RS14360 (WE0438_02941) | 32446..33294 | + | 849 | WP_001258486.1 | streptomycin adenylyltransferase Str | - |
| KJA91_RS14370 (WE0438_02944) | 35028..35630 | - | 603 | WP_002362434.1 | Fic family protein | - |
| KJA91_RS14375 (WE0438_02945) | 35895..36833 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| KJA91_RS14380 (WE0438_02946) | 36945..37286 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| KJA91_RS14385 (WE0438_02947) | 37286..37516 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| KJA91_RS14390 (WE0438_02948) | 37720..38340 | + | 621 | WP_013438829.1 | recombinase family protein | - |
| KJA91_RS14395 (WE0438_02949) | 38357..38641 | + | 285 | WP_002394798.1 | hypothetical protein | - |
| KJA91_RS14400 (WE0438_02950) | 38643..38876 | + | 234 | WP_002394799.1 | hypothetical protein | - |
| KJA91_RS14405 (WE0438_02951) | 39036..39290 | - | 255 | WP_002394800.1 | hypothetical protein | - |
| KJA91_RS14410 (WE0438_02952) | 39407..40075 | - | 669 | WP_002394801.1 | CPBP family intramembrane metalloprotease | - |
| KJA91_RS14415 (WE0438_02953) | 40111..40428 | - | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(L) / tet(M) / str / optrA / fexA / erm(B) | - | 1..61284 | 61284 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T294514 WP_002362432.1 NZ_OD940421:c37286-36945 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |