Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/Peptidase_M78-HTH_26 |
| Location | 1962260..1962958 | Replicon | chromosome |
| Accession | NZ_OD940420 | ||
| Organism | Enterococcus faecalis isolate WE0438 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | A0A828QMF1 |
| Locus tag | KJA91_RS09565 | Protein ID | WP_002388207.1 |
| Coordinates | 1962614..1962958 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | KJA91_RS09560 | Protein ID | WP_002388206.1 |
| Coordinates | 1962260..1962595 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA91_RS09515 (1957726) | 1957726..1958043 | - | 318 | WP_002357007.1 | hypothetical protein | - |
| KJA91_RS09520 (1958263) | 1958263..1958817 | + | 555 | WP_002357006.1 | hypothetical protein | - |
| KJA91_RS09525 (1959102) | 1959102..1959440 | - | 339 | WP_002357003.1 | hypothetical protein | - |
| KJA91_RS09530 (1959477) | 1959477..1959686 | - | 210 | WP_002357002.1 | hypothetical protein | - |
| KJA91_RS09535 (1959741) | 1959741..1959929 | + | 189 | WP_002357001.1 | YegP family protein | - |
| KJA91_RS09540 (1959955) | 1959955..1960677 | - | 723 | WP_002357000.1 | phage regulatory protein | - |
| KJA91_RS09545 (1960700) | 1960700..1961011 | - | 312 | WP_002381719.1 | hypothetical protein | - |
| KJA91_RS09550 (1961608) | 1961608..1961805 | - | 198 | WP_010712611.1 | hypothetical protein | - |
| KJA91_RS09555 (1961818) | 1961818..1962000 | - | 183 | WP_002388205.1 | hypothetical protein | - |
| KJA91_RS09560 (1962260) | 1962260..1962595 | + | 336 | WP_002388206.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| KJA91_RS09565 (1962614) | 1962614..1962958 | + | 345 | WP_002388207.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| KJA91_RS09570 (1963016) | 1963016..1963744 | + | 729 | WP_002388208.1 | potassium channel family protein | - |
| KJA91_RS09575 (1963844) | 1963844..1964992 | + | 1149 | WP_002388210.1 | site-specific integrase | - |
| KJA91_RS09580 (1965020) | 1965020..1965463 | - | 444 | WP_002388212.1 | competence type IV pilus minor pilin ComGD | - |
| KJA91_RS09585 (1965460) | 1965460..1965735 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| KJA91_RS09590 (1965735) | 1965735..1966781 | - | 1047 | WP_002377060.1 | competence type IV pilus assembly protein ComGB | - |
| KJA91_RS09595 (1966738) | 1966738..1967706 | - | 969 | WP_010712613.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13625.58 Da Isoelectric Point: 4.9570
>T294497 WP_002388207.1 NZ_OD940420:1962614-1962958 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPTEQEEAIYHELKHVEDHVDIMALYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPTEQEEAIYHELKHVEDHVDIMALYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|