Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
Location | 2610153..2610941 | Replicon | chromosome |
Accession | NZ_LT996891 | ||
Organism | Staphylococcus aureus isolate 24117-WT |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A2I7Y5B3 |
Locus tag | DYY95_RS13500 | Protein ID | WP_000525004.1 |
Coordinates | 2610153..2610614 (-) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A0E7YIA0 |
Locus tag | DYY95_RS13505 | Protein ID | WP_000333630.1 |
Coordinates | 2610627..2610941 (-) | Length | 105 a.a. |
Genomic Context
Location: 2608431..2609045 (615 bp)
Type: Others
Protein ID: WP_000191464.1
Type: Others
Protein ID: WP_000191464.1
Location: 2611093..2611329 (237 bp)
Type: Others
Protein ID: WP_001121027.1
Type: Others
Protein ID: WP_001121027.1
Location: 2611343..2612119 (777 bp)
Type: Others
Protein ID: WP_001148544.1
Type: Others
Protein ID: WP_001148544.1
Location: 2612148..2612291 (144 bp)
Type: Others
Protein ID: WP_000939498.1
Type: Others
Protein ID: WP_000939498.1
Location: 2612546..2612791 (246 bp)
Type: Others
Protein ID: WP_001025401.1
Type: Others
Protein ID: WP_001025401.1
Location: 2613180..2613395 (216 bp)
Type: Others
Protein ID: WP_001097552.1
Type: Others
Protein ID: WP_001097552.1
Location: 2613422..2613685 (264 bp)
Type: Others
Protein ID: WP_001124198.1
Type: Others
Protein ID: WP_001124198.1
Location: 2613698..2613859 (162 bp)
Type: Others
Protein ID: WP_001285948.1
Type: Others
Protein ID: WP_001285948.1
Location: 2613938..2614261 (324 bp)
Type: Others
Protein ID: WP_000174994.1
Type: Others
Protein ID: WP_000174994.1
Location: 2614276..2614638 (363 bp)
Type: Others
Protein ID: WP_000985976.1
Type: Others
Protein ID: WP_000985976.1
Location: 2614635..2615801 (1167 bp)
Type: Others
Protein ID: WP_000762545.1
Type: Others
Protein ID: WP_000762545.1
Location: 2607100..2608305 (1206 bp)
Type: Others
Protein ID: WP_000264751.1
Type: Others
Protein ID: WP_000264751.1
Location: 2609042..2609188 (147 bp)
Type: Others
Protein ID: WP_001795334.1
Type: Others
Protein ID: WP_001795334.1
Location: 2609277..2609672 (396 bp)
Type: Others
Protein ID: WP_000449655.1
Type: Others
Protein ID: WP_000449655.1
Location: 2609701..2610135 (435 bp)
Type: Others
Protein ID: WP_115657847.1
Type: Others
Protein ID: WP_115657847.1
Location: 2610153..2610614 (462 bp)
Type: Toxin
Protein ID: WP_000525004.1
Type: Toxin
Protein ID: WP_000525004.1
Location: 2610627..2610941 (315 bp)
Type: Antitoxin
Protein ID: WP_000333630.1
Type: Antitoxin
Protein ID: WP_000333630.1
Location: 2612281..2612490 (210 bp)
Type: Others
Protein ID: WP_000642492.1
Type: Others
Protein ID: WP_000642492.1
Location: 2612760..2613125 (366 bp)
Type: Others
Protein ID: WP_001128433.1
Type: Others
Protein ID: WP_001128433.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY95_RS13475 | 2607100..2608305 | - | 1206 | WP_000264751.1 | site-specific integrase | - |
DYY95_RS13480 | 2608431..2609045 | + | 615 | WP_000191464.1 | hypothetical protein | - |
DYY95_RS13485 | 2609042..2609188 | - | 147 | WP_001795334.1 | hypothetical protein | - |
DYY95_RS13490 | 2609277..2609672 | - | 396 | WP_000449655.1 | hypothetical protein | - |
DYY95_RS13495 | 2609701..2610135 | - | 435 | WP_115657847.1 | hypothetical protein | - |
DYY95_RS13500 | 2610153..2610614 | - | 462 | WP_000525004.1 | hypothetical protein | Toxin |
DYY95_RS13505 | 2610627..2610941 | - | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | Antitoxin |
DYY95_RS13510 | 2611093..2611329 | + | 237 | WP_001121027.1 | helix-turn-helix domain-containing protein | - |
DYY95_RS13515 | 2611343..2612119 | + | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
DYY95_RS13520 | 2612148..2612291 | + | 144 | WP_000939498.1 | hypothetical protein | - |
DYY95_RS13525 | 2612281..2612490 | - | 210 | WP_000642492.1 | hypothetical protein | - |
DYY95_RS13530 | 2612546..2612791 | + | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
DYY95_RS13535 | 2612760..2613125 | - | 366 | WP_001128433.1 | hypothetical protein | - |
DYY95_RS13540 | 2613180..2613395 | + | 216 | WP_001097552.1 | hypothetical protein | - |
DYY95_RS13545 | 2613422..2613685 | + | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
DYY95_RS13550 | 2613698..2613859 | + | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
DYY95_RS13555 | 2613938..2614261 | + | 324 | WP_000174994.1 | hypothetical protein | - |
DYY95_RS13560 | 2614276..2614638 | + | 363 | WP_000985976.1 | hypothetical protein | - |
DYY95_RS13565 | 2614635..2615801 | + | 1167 | WP_000762545.1 | DUF2800 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2604110..2655221 | 51111 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T294476 WP_000525004.1 NZ_LT996891:c2610614-2610153 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E7YIA0 |