Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 2610153..2610941 | Replicon | chromosome |
| Accession | NZ_LT996891 | ||
| Organism | Staphylococcus aureus isolate 24117-WT | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A2I7Y5B3 |
| Locus tag | DYY95_RS13500 | Protein ID | WP_000525004.1 |
| Coordinates | 2610153..2610614 (-) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | DYY95_RS13505 | Protein ID | WP_000333630.1 |
| Coordinates | 2610627..2610941 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DYY95_RS13475 | 2607100..2608305 | - | 1206 | WP_000264751.1 | site-specific integrase | - |
| DYY95_RS13480 | 2608431..2609045 | + | 615 | WP_000191464.1 | hypothetical protein | - |
| DYY95_RS13485 | 2609042..2609188 | - | 147 | WP_001795334.1 | hypothetical protein | - |
| DYY95_RS13490 | 2609277..2609672 | - | 396 | WP_000449655.1 | hypothetical protein | - |
| DYY95_RS13495 | 2609701..2610135 | - | 435 | WP_115657847.1 | hypothetical protein | - |
| DYY95_RS13500 | 2610153..2610614 | - | 462 | WP_000525004.1 | hypothetical protein | Toxin |
| DYY95_RS13505 | 2610627..2610941 | - | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DYY95_RS13510 | 2611093..2611329 | + | 237 | WP_001121027.1 | helix-turn-helix domain-containing protein | - |
| DYY95_RS13515 | 2611343..2612119 | + | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| DYY95_RS13520 | 2612148..2612291 | + | 144 | WP_000939498.1 | hypothetical protein | - |
| DYY95_RS13525 | 2612281..2612490 | - | 210 | WP_000642492.1 | hypothetical protein | - |
| DYY95_RS13530 | 2612546..2612791 | + | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| DYY95_RS13535 | 2612760..2613125 | - | 366 | WP_001128433.1 | hypothetical protein | - |
| DYY95_RS13540 | 2613180..2613395 | + | 216 | WP_001097552.1 | hypothetical protein | - |
| DYY95_RS13545 | 2613422..2613685 | + | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| DYY95_RS13550 | 2613698..2613859 | + | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
| DYY95_RS13555 | 2613938..2614261 | + | 324 | WP_000174994.1 | hypothetical protein | - |
| DYY95_RS13560 | 2614276..2614638 | + | 363 | WP_000985976.1 | hypothetical protein | - |
| DYY95_RS13565 | 2614635..2615801 | + | 1167 | WP_000762545.1 | DUF2800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2604110..2655221 | 51111 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T294476 WP_000525004.1 NZ_LT996891:c2610614-2610153 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |