Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 2230957..2231733 | Replicon | chromosome |
Accession | NZ_LT996891 | ||
Organism | Staphylococcus aureus isolate 24117-WT |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | DYY95_RS11500 | Protein ID | WP_000031108.1 |
Coordinates | 2231581..2231733 (+) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DYY95_RS11495 | Protein ID | WP_001251224.1 |
Coordinates | 2230957..2231556 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY95_RS11475 | 2226874..2228331 | + | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
DYY95_RS11480 | 2228324..2229046 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
DYY95_RS11485 | 2229197..2230324 | + | 1128 | WP_000379985.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DYY95_RS11490 | 2230329..2230799 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DYY95_RS11495 | 2230957..2231556 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DYY95_RS11500 | 2231581..2231733 | + | 153 | WP_000031108.1 | hypothetical protein | Toxin |
DYY95_RS11520 | 2232860..2233255 | + | 396 | WP_000901021.1 | hypothetical protein | - |
DYY95_RS11525 | 2233451..2234836 | + | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
DYY95_RS11530 | 2235297..2236118 | - | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T294475 WP_000031108.1 NZ_LT996891:2231581-2231733 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT294475 WP_001251224.1 NZ_LT996891:2230957-2231556 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|