Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 2610151..2610939 Replicon chromosome
Accession NZ_LT996890
Organism Staphylococcus aureus isolate 24117-SCV

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag DYY94_RS13500 Protein ID WP_000525004.1
Coordinates 2610151..2610612 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag DYY94_RS13505 Protein ID WP_000333630.1
Coordinates 2610625..2610939 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DYY94_RS13475 2607098..2608303 - 1206 WP_000264751.1 site-specific integrase -
DYY94_RS13480 2608429..2609043 + 615 WP_000191464.1 hypothetical protein -
DYY94_RS13485 2609040..2609186 - 147 WP_001795334.1 hypothetical protein -
DYY94_RS13490 2609275..2609670 - 396 WP_000449655.1 hypothetical protein -
DYY94_RS13495 2609699..2610133 - 435 WP_115657847.1 hypothetical protein -
DYY94_RS13500 2610151..2610612 - 462 WP_000525004.1 hypothetical protein Toxin
DYY94_RS13505 2610625..2610939 - 315 WP_000333630.1 helix-turn-helix domain-containing protein Antitoxin
DYY94_RS13510 2611091..2611327 + 237 WP_001121027.1 helix-turn-helix domain-containing protein -
DYY94_RS13515 2611341..2612117 + 777 WP_001148544.1 Rha family transcriptional regulator -
DYY94_RS13520 2612146..2612289 + 144 WP_000939498.1 hypothetical protein -
DYY94_RS13525 2612279..2612488 - 210 WP_000642492.1 hypothetical protein -
DYY94_RS13530 2612544..2612789 + 246 WP_001025401.1 DUF2829 domain-containing protein -
DYY94_RS13535 2612758..2613123 - 366 WP_001128433.1 hypothetical protein -
DYY94_RS13540 2613178..2613393 + 216 WP_001097552.1 hypothetical protein -
DYY94_RS13545 2613420..2613683 + 264 WP_001124198.1 helix-turn-helix domain-containing protein -
DYY94_RS13550 2613696..2613857 + 162 WP_001285948.1 DUF1270 domain-containing protein -
DYY94_RS13555 2613936..2614259 + 324 WP_000174994.1 hypothetical protein -
DYY94_RS13560 2614274..2614636 + 363 WP_000985976.1 hypothetical protein -
DYY94_RS13565 2614633..2615799 + 1167 WP_000762545.1 DUF2800 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2604108..2655219 51111


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T294463 WP_000525004.1 NZ_LT996890:c2610612-2610151 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT294463 WP_000333630.1 NZ_LT996890:c2610939-2610625 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References