Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2074078..2074607 | Replicon | chromosome |
Accession | NZ_LT996889 | ||
Organism | Staphylococcus aureus isolate 24117-REV |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DYY93_RS10550 | Protein ID | WP_000621175.1 |
Coordinates | 2074245..2074607 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DYY93_RS10545 | Protein ID | WP_000948331.1 |
Coordinates | 2074078..2074248 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY93_RS10515 | 2069114..2069674 | + | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
DYY93_RS10520 | 2069883..2070362 | + | 480 | WP_001287079.1 | hypothetical protein | - |
DYY93_RS10525 | 2070355..2071938 | + | 1584 | WP_001294620.1 | PH domain-containing protein | - |
DYY93_RS10530 | 2071925..2072416 | + | 492 | WP_001205912.1 | PH domain-containing protein | - |
DYY93_RS10535 | 2072420..2072779 | + | 360 | WP_000581202.1 | holo-ACP synthase | - |
DYY93_RS10540 | 2072845..2073993 | + | 1149 | WP_000130547.1 | alanine racemase | - |
DYY93_RS10545 | 2074078..2074248 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DYY93_RS10550 | 2074245..2074607 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DYY93_RS10560 | 2074956..2075957 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DYY93_RS10565 | 2076076..2076402 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DYY93_RS10570 | 2076404..2076883 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
DYY93_RS10575 | 2076858..2077628 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294448 WP_000621175.1 NZ_LT996889:2074245-2074607 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|