Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 590267..590744 Replicon chromosome
Accession NZ_LT996889
Organism Staphylococcus aureus isolate 24117-REV

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DYY93_RS02985 Protein ID WP_000052076.1
Coordinates 590556..590744 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DYY93_RS02980 Protein ID WP_001059690.1
Coordinates 590267..590527 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DYY93_RS02950 585426..585920 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
DYY93_RS02955 586260..587906 + 1647 WP_000277718.1 IS1182 family transposase -
DYY93_RS02960 587994..588611 + 618 WP_000255557.1 LysE/ArgO family amino acid transporter -
DYY93_RS02965 588684..589265 - 582 WP_001140693.1 phosphoglycerate mutase family protein -
DYY93_RS02970 589490..589726 + 237 WP_000368687.1 hypothetical protein -
DYY93_RS02975 589723..589926 - 204 WP_000145164.1 sterile alpha motif-like domain-containing protein -
DYY93_RS02980 590267..590527 + 261 WP_001059690.1 hypothetical protein Antitoxin
DYY93_RS02985 590556..590744 + 189 WP_000052076.1 hypothetical protein Toxin
DYY93_RS02990 590932..591501 + 570 WP_001106654.1 hypothetical protein -
DYY93_RS02995 591589..591873 + 285 WP_001004401.1 hypothetical protein -
DYY93_RS03000 591935..592153 + 219 WP_000005886.1 hypothetical protein -
DYY93_RS03005 592649..592849 - 201 WP_001059082.1 cold-shock protein -
DYY93_RS03010 593206..593892 - 687 WP_001641381.1 thermonuclease family protein -
DYY93_RS03015 594233..594703 - 471 WP_000824467.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp 585426..604636 19210
- flank IS/Tn - - 586260..587906 1646


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294440 WP_000052076.1 NZ_LT996889:590556-590744 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294440 WP_001059690.1 NZ_LT996889:590267-590527 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References