Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1634704..1635338 | Replicon | chromosome |
Accession | NZ_LT996886 | ||
Organism | Tessaracoccus timonensis strain Marseille-P5995 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | DHT94_RS07760 | Protein ID | WP_108871336.1 |
Coordinates | 1634940..1635338 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | DHT94_RS07755 | Protein ID | WP_108871335.1 |
Coordinates | 1634704..1634946 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DHT94_RS07740 | 1631532..1632701 | - | 1170 | WP_108871332.1 | MFS transporter | - |
DHT94_RS07745 | 1632698..1633111 | - | 414 | WP_108871333.1 | hypothetical protein | - |
DHT94_RS07750 | 1633275..1634669 | + | 1395 | WP_108871334.1 | amidase | - |
DHT94_RS07755 | 1634704..1634946 | + | 243 | WP_108871335.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
DHT94_RS07760 | 1634940..1635338 | + | 399 | WP_108871336.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DHT94_RS07765 | 1635386..1636678 | + | 1293 | WP_108871337.1 | thymidine phosphorylase | - |
DHT94_RS13290 | 1636675..1637295 | + | 621 | WP_159087448.1 | hypothetical protein | - |
DHT94_RS07775 | 1637496..1637867 | + | 372 | WP_108871339.1 | hypothetical protein | - |
DHT94_RS07780 | 1637877..1638749 | - | 873 | WP_159087449.1 | aminotransferase class IV | - |
DHT94_RS07790 | 1639156..1640061 | - | 906 | WP_108871341.1 | metallophosphoesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.02 Da Isoelectric Point: 7.1362
>T294439 WP_108871336.1 NZ_LT996886:1634940-1635338 [Tessaracoccus timonensis]
MVTYLLDTSIWIELLRGNESVVQRMQRCSPRDIRLSPIVQGELETGRQLSQSADQAEMLEWVYHSFPRNAFGDTVARQCG
VVRAQLRRAGTPIGVNDTWIAAEALAHGQTVVTANERDFRRVPGLKVENWMV
MVTYLLDTSIWIELLRGNESVVQRMQRCSPRDIRLSPIVQGELETGRQLSQSADQAEMLEWVYHSFPRNAFGDTVARQCG
VVRAQLRRAGTPIGVNDTWIAAEALAHGQTVVTANERDFRRVPGLKVENWMV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|