Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 791656..792338 | Replicon | chromosome |
Accession | NZ_LT996886 | ||
Organism | Tessaracoccus timonensis strain Marseille-P5995 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | DHT94_RS03970 | Protein ID | WP_108870684.1 |
Coordinates | 791907..792338 (+) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | DHT94_RS03965 | Protein ID | WP_108870683.1 |
Coordinates | 791656..791907 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DHT94_RS03935 | 787423..787956 | + | 534 | WP_197709372.1 | fumarate hydratase | - |
DHT94_RS03940 | 788072..789073 | - | 1002 | WP_197709373.1 | NADP-dependent oxidoreductase | - |
DHT94_RS03945 | 789066..789470 | + | 405 | WP_005885516.1 | helix-turn-helix transcriptional regulator | - |
DHT94_RS13210 | 789913..790317 | + | 405 | WP_159087358.1 | hypothetical protein | - |
DHT94_RS03955 | 790393..790713 | + | 321 | WP_197709374.1 | hypothetical protein | - |
DHT94_RS03960 | 791316..791522 | - | 207 | WP_159087359.1 | hypothetical protein | - |
DHT94_RS03965 | 791656..791907 | + | 252 | WP_108870683.1 | antitoxin | Antitoxin |
DHT94_RS03970 | 791907..792338 | + | 432 | WP_108870684.1 | PIN domain-containing protein | Toxin |
DHT94_RS03975 | 792467..793216 | - | 750 | WP_159087360.1 | ABC transporter permease | - |
DHT94_RS03980 | 793399..793614 | + | 216 | WP_108870686.1 | mandelate racemase | - |
DHT94_RS03985 | 793722..794483 | + | 762 | WP_108872330.1 | sulfite exporter TauE/SafE family protein | - |
DHT94_RS03990 | 794524..795633 | - | 1110 | WP_197709481.1 | zinc-binding dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15606.75 Da Isoelectric Point: 5.8960
>T294438 WP_108870684.1 NZ_LT996886:791907-792338 [Tessaracoccus timonensis]
MLLVDTNVLIYAVNASSAHHDASRTWFLHELQSGTDVVGLPWVSLLGFIRISTHSHILEHPLSPEEAMSVVHAWLNHPRV
VTPEPSPRHAALLAGLLAESGTAGNLTNDAHLAALALELDATMVTFDRDFARFGVRVLVPEHE
MLLVDTNVLIYAVNASSAHHDASRTWFLHELQSGTDVVGLPWVSLLGFIRISTHSHILEHPLSPEEAMSVVHAWLNHPRV
VTPEPSPRHAALLAGLLAESGTAGNLTNDAHLAALALELDATMVTFDRDFARFGVRVLVPEHE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|