294435

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 656802..657457 Replicon chromosome
Accession NZ_LT996886
Organism Tessaracoccus timonensis strain Marseille-P5995

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag DHT94_RS03185 Protein ID WP_108870570.1
Coordinates 656802..657227 (-) Length 142 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag DHT94_RS03190 Protein ID WP_108872311.1
Coordinates 657224..657457 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DHT94_RS03150 652328..652771 + 444 WP_108870563.1 aminoacyl-tRNA hydrolase -
DHT94_RS03155 652787..653149 + 363 WP_159087339.1 hypothetical protein -
DHT94_RS03160 653274..654305 - 1032 WP_108870565.1 LLM class flavin-dependent oxidoreductase -
DHT94_RS13440 654535..654663 + 129 Protein_618 transposase -
DHT94_RS03170 654730..655554 - 825 WP_108870567.1 alpha/beta hydrolase -
DHT94_RS03175 655610..656389 - 780 WP_108870568.1 biotin--protein ligase -
DHT94_RS03180 656569..656805 - 237 WP_108870569.1 hypothetical protein -
DHT94_RS03185 656802..657227 - 426 WP_108870570.1 type II toxin-antitoxin system VapC family toxin Toxin
DHT94_RS03190 657224..657457 - 234 WP_108872311.1 Arc family DNA-binding protein Antitoxin
DHT94_RS03195 657611..657946 - 336 WP_197709356.1 HigA family addiction module antidote protein -
DHT94_RS03200 657906..658151 - 246 WP_108870571.1 type II toxin-antitoxin system RelE/ParE family toxin -
DHT94_RS03205 658731..659273 + 543 WP_108872313.1 DUF488 domain-containing protein -
DHT94_RS03215 659582..659881 - 300 WP_108870572.1 HigA family addiction module antidote protein -
DHT94_RS03220 659890..660171 - 282 WP_108870573.1 type II toxin-antitoxin system RelE/ParE family toxin -
DHT94_RS03225 660415..660744 - 330 WP_108870574.1 nucleotidyltransferase domain-containing protein -
DHT94_RS03230 660847..661242 - 396 WP_197709357.1 GNAT family N-acetyltransferase -
DHT94_RS03235 661392..661817 - 426 WP_108870575.1 type II toxin-antitoxin system VapC family toxin -
DHT94_RS03240 661814..662047 - 234 WP_108870576.1 Arc family DNA-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-128)

Antitoxin

Arc-like DNA binding domain

(12-40)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 14968.05 Da        Isoelectric Point: 4.3705

>T294435 WP_108870570.1 NZ_LT996886:c657227-656802 [Tessaracoccus timonensis]
VIVLDTNVVSEIFRSSLEPRVVEWLVSLTGDVAITSVTLAELLAGVRRLPEGRCKDALAYGIEGAVVPYRGSRSVLAFDA
DAAERYAEVLVSREAAGVPVSIADAQIAAICLANGATCATRNVKDFQHTGVELVDPWNVEA

Download         Length: 426 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8470.63 Da        Isoelectric Point: 6.2176

>AT294435 WP_108872311.1 NZ_LT996886:c657457-657224 [Tessaracoccus timonensis]
MSSIIVRGLDDHVKQQLASRAKEHGRSMEAEVRDILTKAARRPHIGVALLNVAQDVGGVDELPIQARDDVARVVDFE

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References