Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 1401261..1401805 | Replicon | chromosome |
Accession | NZ_LT996885 | ||
Organism | Dialister massiliensis strain Marseille-P5638 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | DHT67_RS06500 | Protein ID | WP_022381609.1 |
Coordinates | 1401530..1401805 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | DHT67_RS06495 | Protein ID | WP_022381610.1 |
Coordinates | 1401261..1401533 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DHT67_RS06475 | 1397445..1398860 | + | 1416 | WP_108850317.1 | DNA primase family protein | - |
DHT67_RS06480 | 1399006..1399287 | + | 282 | WP_108850318.1 | VRR-NUC domain-containing protein | - |
DHT67_RS06485 | 1399268..1400623 | + | 1356 | WP_108850319.1 | DEAD/DEAH box helicase | - |
DHT67_RS06490 | 1400620..1401078 | + | 459 | WP_108850320.1 | hypothetical protein | - |
DHT67_RS06495 | 1401261..1401533 | + | 273 | WP_022381610.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
DHT67_RS06500 | 1401530..1401805 | + | 276 | WP_022381609.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
DHT67_RS06505 | 1402082..1402462 | + | 381 | WP_108850321.1 | HNH endonuclease | - |
DHT67_RS06510 | 1402592..1403158 | + | 567 | WP_108850322.1 | P27 family phage terminase small subunit | - |
DHT67_RS06515 | 1403161..1404390 | + | 1230 | WP_108850323.1 | DNA modification methylase | - |
DHT67_RS06520 | 1404390..1404938 | + | 549 | WP_108850324.1 | N-acetylmuramoyl-L-alanine amidase | - |
DHT67_RS06525 | 1404940..1405215 | + | 276 | WP_108850325.1 | prevent-host-death protein | - |
DHT67_RS06530 | 1405305..1405994 | + | 690 | WP_108850326.1 | virulence protein | - |
DHT67_RS06535 | 1405978..1406205 | + | 228 | WP_074502258.1 | DUF4314 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1397640..1421569 | 23929 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10766.43 Da Isoelectric Point: 7.2406
>T294433 WP_022381609.1 NZ_LT996885:1401530-1401805 [Dialister massiliensis]
MKYEVKFTTQFKKDLKLAKKQNKDIDVLFSVIEQLAQGKQLDEKYRDHDLGGTYKGCRECHIDPDWLLIYETKDDVLVLL
LYRLGSHSQLF
MKYEVKFTTQFKKDLKLAKKQNKDIDVLFSVIEQLAQGKQLDEKYRDHDLGGTYKGCRECHIDPDWLLIYETKDDVLVLL
LYRLGSHSQLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|